Your browser is old and dusty. Try Google Chrome!

Details for sll0222

ORF sll0222
Accession NP_440042.1
Symbol
Category Other
Definition putative purple acid phosphatase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -118 -104 11.2093 0.0531
NP_441061.1_2 Forward -112 -98 3.04785 0.168
NP_441061.1_2 Forward -305 -291 0.88457 0.197
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_440795.1_10 Forward -37 -18 13.8633 0.217
NP_441418.1_6 Reverse -110 -129 -20.4534 0.114
NP_441418.1_6 Reverse -2 -21 -27.8282 0.203
NP_441418.1_6 Forward -306 -287 -29.7948 0.238
NP_441418.1_6 Forward -119 -100 -30.6798 0.291
NP_440897.1_6 Forward -119 -100 10.3234 0.0705
NP_441453.1_4 Reverse -110 -118 16.539 0.00633
NP_441453.1_4 Forward -119 -111 7.8859 0.0536
NP_442151.1_6 Forward -119 -105 9.83269 0.139
NP_442151.1_6 Reverse -14 -28 7.9644 0.184
NP_442151.1_6 Reverse -110 -124 6.58777 0.228
NP_442838.1_7 Reverse -105 -124 -1.7705 0.143
NP_441818.1_1 Forward -118 -107 9.30127 0.246
NP_441818.1_1 Reverse -111 -122 9.10461 0.255
NP_441818.1_7 Forward -147 -128 16.4199 0.192
NP_441630.1_3 Forward -127 -108 3.93269 0.18
NP_441630.1_3 Reverse -102 -121 1.86774 0.236
NP_440259.1_4 Forward -195 -181 10.6604 0.262
NP_440150.1_2 Reverse -28 -47 7.27514 0.247
NP_440150.1_6 Forward -116 -97 0.491109 0.3
NP_442173.1_1 Forward -118 -110 15.4574 0.00633
NP_442173.1_1 Reverse -111 -119 8.27922 0.101
NP_442752.1_4 Reverse -110 -117 13.8055 0.0199
NP_442752.1_4 Forward -174 -167 7.6106 0.151
NP_443027.1_4 Reverse -108 -118 14.828 0.0437
NP_442975.1_10 Reverse -106 -120 3.8339 0.252
NP_442975.1_10 Forward -123 -109 2.8506 0.269
NP_441675.1_4 Forward -91 -72 3.6377 0.264
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_440784.1_8 Reverse -293 -312 19.5673 0.138
NP_441681.1_9 Reverse -179 -193 13.7659 0.19
NP_440061.1_9 Reverse -108 -122 8.25877 0.177
NP_440110.1_8 Forward -121 -102 0.58944 0.211
NP_440878.1_9 Forward -129 -110 -1.96717 0.258
NP_442062.1_8 Forward -119 -109 9.91146 0.0554
NP_442062.1_8 Reverse -110 -120 9.41981 0.0625
NP_441859.1_3 Reverse -109 -128 9.34008 0.129
NP_441859.1_3 Reverse -296 -315 2.16195 0.266
NP_441802.1_1 Forward -98 -79 4.03102 0.298
NP_440304.1_4 Reverse -108 -118 10.8948 0.051
NP_440304.1_4 Forward -121 -111 8.1415 0.0859
NP_442242.1_1 Forward -116 -97 19.045 0.28
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_440044.1_8 Forward -154 -135 1.0811 0.183
NP_440044.1_8 Reverse -78 -97 -2.45882 0.264
NP_441492.1_7 Reverse -90 -109 17.6982 0.0931
NP_442048.1_9 Forward -294 -275 9.3409 0.276
NP_441935.1_10 Forward -313 -294 19.5673 0.0924
NP_440307.1_8 Forward -128 -109 17.109 0.177
NP_440764.1_3 Forward -301 -283 10.1472 0.277
NP_442110.1_7 Forward -119 -105 3.73617 0.21
NP_441925.1_4 Reverse -278 -297 -13.1776 0.257
NP_441925.1_4 Forward -148 -129 -15.0459 0.263
NP_441925.1_4 Forward -30 -11 -17.1108 0.288
NP_441083.1_5 Forward -119 -109 10.1081 0.0208
NP_441083.1_5 Reverse -110 -120 9.61647 0.0243
NP_442827.1_8 Reverse -102 -121 6.68515 0.103
NP_442827.1_8 Forward -127 -108 1.27698 0.184
NP_441149.1_9 Forward -36 -17 2.16195 0.221
NP_441738.1_2 Forward -117 -110 15.28 0.0102
NP_441955.1_8 Reverse -104 -121 7.11867 0.281
NP_440209.1_1 Reverse -110 -118 18.1123 0.00295
NP_440209.1_1 Forward -119 -111 15.1624 0.00583
NP_442889.1_8 Reverse -175 -189 5.40719 0.227
NP_441713.1_3 Forward -128 -109 6.78429 0.249
NP_440178.1_7 Forward -120 -101 -13.7669 0.143
NP_440659.1_7 Reverse -175 -194 8.06259 0.243
NP_441716.1_1 Forward -180 -166 11.406 0.0936
NP_441716.1_1 Reverse -110 -124 4.52282 0.255
NP_442111.1_4 Forward -120 -106 15.9292 0.0188
NP_441163.1_1 Reverse -102 -119 14.5911 0.175
NP_441387.1_7 Reverse -267 -286 5.99764 0.209
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_440747.1_1 Forward -121 -103 6.214 0.259
NP_440747.1_10 Reverse -107 -119 -11.7607 0.142
NP_440747.1_10 Forward -122 -110 -11.8591 0.161
NP_440747.1_10 Reverse -101 -113 -12.2524 0.254
NP_441130.1_10 Forward -121 -107 10.0294 0.117
NP_441130.1_10 Reverse -108 -122 4.52282 0.281
NP_441486.1_1 Reverse -107 -121 5.40779 0.037
NP_442634.1_4 Forward -121 -107 -5.60527 0.264
NP_440403.1_10 Forward -121 -102 4.81767 0.251
NP_441014.1_8 Reverse -105 -124 0.491109 0.218
NP_442848.1_1 Reverse -104 -118 -1.18038 0.263
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_440376.1_1 Reverse -110 -119 9.73449 0.0365
NP_440376.1_1 Forward -119 -110 9.63616 0.0385
NP_442730.1_8 Reverse -102 -121 3.63691 0.275
NP_442687.1_7 Forward -120 -110 15.8113 0.0125
NP_442687.1_7 Reverse -109 -119 6.76487 0.154
NP_441846.1_10 Reverse -199 -218 -15.2418 0.246
NP_440642.1_10 Forward -34 -20 2.94893 0.277
NP_440042.1_1 Forward -321 -302 21.5339 0.0222
NP_440042.1_2 Forward -129 -110 28.3188 0.0017
NP_440042.1_3 Forward -155 -136 25.3688 0.00701
NP_440042.1_7 Forward -109 -96 25.6837 0.0215
NP_440042.1_8 Forward -257 -238 27.9255 0.000767
NP_441950.1_6 Forward -147 -128 19.7631 0.0986
NP_440887.1_4 Forward -187 -168 18.1901 0.16
NP_442720.1_6 Forward -369 -350 10.7175 0.18
NP_442658.1_1 Reverse -108 -118 15.9091 0.00966
NP_442658.1_1 Forward -121 -111 15.5158 0.0122
NP_440669.1_8 Forward -31 -12 18.9765 0.235
NP_441414.1_9 Forward -119 -100 5.40766 0.048
NP_441414.1_9 Forward -104 -85 -9.44032 0.259
NP_441414.1_9 Reverse -110 -129 -10.4236 0.284
NP_441487.1_6 Reverse -102 -121 -1.67217 0.285
NP_441256.1_1 Forward -309 -290 -7.37537 0.239
NP_441958.1_5 Forward -120 -110 10.6981 0.0112
NP_441958.1_5 Reverse -109 -119 3.12662 0.0364
NP_442816.1_7 Forward -387 -368 3.77151 0.287
NP_439905.1_1 Reverse -141 -154 13.6873 0.155
NP_442876.1_6 Reverse -59 -77 13.6573 0.23
NP_440984.1_7 Reverse -99 -113 4.52282 0.299
NP_441097.1_2 Reverse -125 -142 7.41366 0.245
NP_442911.1_2 Reverse -100 -119 -5.60541 0.163
NP_442911.1_2 Forward -129 -110 -9.83364 0.264
NP_440153.1_5 Forward -118 -104 20.0591 0.034
NP_443055.1_2 Forward -192 -173 14.9458 0.127
NP_443055.1_6 Reverse -110 -128 7.98318 0.15
NP_443055.1_6 Forward -127 -109 4.34495 0.182
NP_440993.1_2 Reverse -105 -121 8.80999 0.133
NP_441099.1_5 Forward -129 -110 2.0644 0.0584
NP_441099.1_5 Forward -211 -192 -11.2103 0.273
NP_442002.1_9 Reverse -109 -116 10.7572 0.185
NP_442598.1_2 Forward -191 -182 14.2577 0.252
NP_442438.1_10 Reverse -105 -119 8.65272 0.0749
NP_442431.1_10 Forward -180 -162 2.96908 0.226
NP_440811.1_6 Reverse -298 -317 19.764 0.0746
NP_441000.1_6 Forward -120 -106 6.6861 0.0933
NP_442771.1_1 Forward -121 -103 -8.53565 0.198
NP_442771.1_1 Reverse -108 -126 -8.53565 0.198
NP_440147.1_4 Reverse -108 -121 3.75586 0.181
NP_441295.1_4 Reverse -105 -124 -3.24547 0.29
NP_441550.1_8 Forward -121 -111 16.2041 0.0132
NP_441550.1_8 Reverse -108 -118 6.0761 0.214
NP_441916.1_7 Forward -119 -109 10.2065 0.0266
NP_441916.1_7 Reverse -110 -120 7.55152 0.0639
NP_441041.1_4 Reverse -204 -223 -13.3736 0.285
NP_441041.1_7 Forward -122 -110 9.84704 0.107
NP_442004.1_6 Forward -119 -105 4.81781 0.202
NP_441725.1_5 Reverse -111 -121 16.7946 0.0247
NP_441725.1_5 Forward -118 -108 11.2881 0.0247
NP_439966.1_7 Reverse -108 -118 18.4657 0.00473
NP_439966.1_7 Forward -121 -111 8.82935 0.13
NP_439966.1_9 Forward -121 -112 9.93116 0.186
NP_439966.1_9 Reverse -108 -117 0.983037 0.253
NP_442941.1_3 Forward -118 -108 11.4848 0.0116
NP_440674.1_3 Forward -112 -93 6.09597 0.225
NP_440289.1_2 Reverse -107 -120 13.4906 0.0132
NP_440289.1_2 Forward -122 -109 4.34585 0.0673
NP_442281.1_1 Forward -124 -110 2.35894 0.269
NP_442281.1_1 Reverse -105 -119 1.86729 0.285
NP_441334.1_7 Forward -121 -102 -21.3384 0.296
NP_440018.1_9 Reverse -100 -119 18.879 0.1
NP_442256.1_2 Forward -121 -103 11.6222 0.0965
NP_440437.1_1 Reverse -104 -123 -1.67217 0.205
NP_440647.1_1 Reverse -159 -178 7.27595 0.112
NP_443030.1_3 Forward -125 -107 10.7372 0.183
NP_441644.1_6 Reverse -110 -120 11.9759 0.0408
NP_441644.1_6 Forward -119 -109 7.45273 0.124
NP_443049.1_6 Reverse -109 -119 11.0554 0.282
NP_442029.1_6 Forward -351 -332 5.99764 0.246
NP_442029.1_6 Forward -124 -105 3.93269 0.274
NP_442029.1_6 Reverse -113 -132 3.53937 0.282
NP_442247.1_8 Reverse -108 -122 11.6026 0.247
NP_440929.1_8 Reverse -110 -119 9.93116 0.0249
NP_440929.1_8 Forward -119 -110 9.83282 0.0254
NP_442933.1_10 Reverse -110 -119 9.04618 0.063
NP_442933.1_10 Forward -119 -110 8.94785 0.0643
NP_441751.2_8 Reverse -111 -125 -3.73699 0.154
NP_441751.2_8 Forward -112 -98 -5.50694 0.214
NP_442554.1_8 Forward -118 -108 13.8447 0.0145
NP_442554.1_8 Reverse -111 -121 7.45319 0.092
NP_442554.1_8 Forward -112 -102 3.32329 0.23
NP_441762.1_7 Reverse -109 -121 13.8053 0.0142
NP_441762.1_7 Forward -120 -108 3.97222 0.0602
NP_442142.1_4 Reverse -168 -181 18.3082 0.0255
NP_442142.1_4 Forward -122 -109 9.16348 0.101
NP_442292.1_1 Forward -118 -109 9.63616 0.0183
NP_442292.1_1 Reverse -111 -120 0.688044 0.23
NP_442292.1_5 Forward -123 -104 -0.688862 0.257
NP_440045.1_1 Reverse -259 -277 18.997 0.143
NP_440045.1_5 Reverse -329 -345 24.248 0.0114
NP_442381.1_8 Reverse -107 -126 -3.24547 0.126
NP_442381.1_8 Forward -130 -111 -13.2752 0.268
NP_443009.1_5 Forward -120 -109 10.8746 0.0717
NP_441715.1_4 Forward -118 -108 16.303 0.0117
NP_441448.1_1 Forward -115 -96 8.45592 0.206
NP_441198.1_8 Forward -121 -111 12.0017 0.167
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441020.2_6 Reverse -108 -125 8.39697 0.2
NP_441015.1_10 Reverse -195 -214 -5.01543 0.215
NP_441673.1_1 Reverse -110 -119 11.1111 0.0121
NP_441673.1_1 Forward -119 -110 11.0128 0.018
NP_441826.1_2 Reverse -104 -118 21.4357 0.00561
NP_441826.1_2 Forward -125 -111 1.86788 0.14
NP_441764.1_8 Reverse -28 -38 11.6935 0.284
NP_442868.1_6 Forward -121 -111 16.4996 0.0156
NP_442868.1_6 Reverse -108 -118 0.963343 0.205
NP_442868.1_6 Reverse -102 -112 0.275027 0.243
NP_442719.1_2 Forward -38 -20 -11.4863 0.292
NP_441056.1_1 Forward -287 -268 -8.16202 0.282
NP_442808.1_1 Forward -120 -110 9.12434 0.0481
NP_442808.1_1 Reverse -109 -119 8.73102 0.0481
NP_441101.1_5 Forward -257 -239 15.727 0.246
NP_442542.1_2 Forward -121 -108 10.5407 0.126
NP_442542.1_9 Reverse -103 -117 11.012 0.111
NP_442050.1_5 Forward -121 -111 13.9425 0.0265
NP_442050.1_5 Reverse -108 -118 9.12434 0.193
NP_442342.1_9 Reverse -12 -28 3.59845 0.26
NP_440558.1_2 Reverse -137 -156 -3.63879 0.237
NP_440558.1_2 Forward -153 -134 -5.31042 0.256
NP_441518.1_3 Reverse -341 -360 -15.4385 0.293
NP_441878.1_6 Forward -120 -110 10.4031 0.0176
NP_441878.1_6 Reverse -109 -119 0.668351 0.139
NP_441878.1_6 Reverse -13 -23 -7.19813 0.21
NP_441036.1_8 Reverse -109 -119 8.1415 0.176
NP_441036.1_8 Forward -120 -110 6.07655 0.242
NP_442650.1_2 Forward -287 -273 11.111 0.13
NP_442721.1_3 Reverse -103 -122 15.5357 0.208
NP_441557.1_5 Reverse -110 -119 10.8161 0.00464
NP_441557.1_5 Forward -119 -110 10.4228 0.00915
NP_442066.2_4 Forward -119 -100 2.3594 0.134
NP_442419.1_2 Reverse -105 -124 -5.21209 0.295
NP_441308.1_8 Reverse -108 -118 10.1081 0.22
NP_442183.1_1 Reverse -110 -124 17.7975 0.00938
NP_442397.1_9 Reverse -318 -337 2.55606 0.273
NP_442347.1_2 Forward -118 -109 11.1111 0.056
NP_441037.1_4 Forward -121 -111 9.75413 0.21
NP_441037.1_4 Reverse -108 -118 7.02532 0.237
NP_442594.1_7 Forward -130 -111 3.83357 0.297
NP_442594.1_8 Reverse -12 -31 1.67108 0.298
NP_440563.1_2 Reverse -358 -375 18.9184 0.102
NP_441633.1_3 Reverse -108 -121 5.72248 0.0481
NP_441633.1_3 Forward -25 -12 -5.97891 0.236
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_442590.1_10 Forward -119 -100 5.11266 0.267
NP_442998.1_5 Reverse -29 -39 11.6814 0.179
NP_442998.1_5 Reverse -28 -38 11.0914 0.196
NP_442998.1_10 Forward -117 -110 15.5754 0.0102
NP_442998.1_10 Reverse -112 -119 5.84064 0.235
NP_440299.1_1 Reverse -106 -119 9.26181 0.0749
NP_440299.1_1 Forward -27 -14 3.7553 0.232
NP_441799.1_1 Forward -123 -109 10.717 0.0683
NP_441799.1_9 Forward -120 -101 9.43923 0.108
NP_441007.1_5 Forward -179 -160 8.84924 0.255
NP_441007.1_10 Forward -124 -111 7.39411 0.142
NP_441007.1_10 Reverse -9 -22 -1.06236 0.3
NP_442201.1_10 Reverse -99 -118 -3.83545 0.152
NP_442961.1_4 Forward -326 -307 3.73603 0.288
NP_441559.1_4 Forward -189 -170 4.22769 0.156
NP_441559.1_8 Reverse -105 -119 -7.2769 0.289
NP_441270.1_5 Reverse -122 -141 15.7268 0.191
NP_440915.1_6 Reverse -106 -120 4.12949 0.0999
NP_441179.1_1 Reverse -107 -126 33.6286 0.000037
NP_441179.1_2 Reverse -268 -287 19.9606 0.000282
NP_441179.1_4 Reverse -331 -350 16.9115 0.0786
NP_441179.1_5 Reverse -139 -158 29.3021 0.000131
NP_440717.1_1 Forward -118 -99 5.01433 0.284
NP_442967.1_10 Reverse -103 -117 15.609 0.237
NP_441464.1_8 Reverse -110 -124 8.94771 0.192
NP_440702.1_2 Forward -170 -151 0.491109 0.257
NP_441939.1_3 Forward -118 -99 5.30933 0.28
NP_441199.1_6 Reverse -106 -125 11.4058 0.0684
NP_441494.1_6 Forward -224 -211 9.06573 0.227
NP_441494.1_6 Forward -283 -270 5.72248 0.294
NP_442386.1_9 Reverse -109 -118 15.7322 0.0144
NP_442386.1_9 Forward -120 -111 8.35743 0.201
NP_442386.1_9 Forward -128 -119 7.07914 0.219
NP_441750.1_4 Reverse -106 -125 4.03102 0.223
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_440168.1_4 Forward -123 -104 -5.9004 0.255
NP_442240.1_2 Forward -118 -99 -16.3235 0.244
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_440684.1_9 Reverse -104 -118 7.37441 0.266
NP_441262.1_3 Reverse -110 -117 14.7888 0.0223
NP_441262.1_3 Forward -119 -112 6.52896 0.0809
NP_443051.1_1 Reverse -109 -118 10.4228 0.00754
NP_443051.1_1 Forward -120 -111 8.65285 0.029
NP_439996.1_6 Reverse -94 -113 8.39919 0.253
NP_441232.1_10 Forward -180 -161 7.86593 0.142
NP_439937.1_8 Forward -121 -102 0.294447 0.235
NP_439937.1_9 Forward -120 -103 -0.551837 0.122
NP_440439.1_1 Reverse -107 -120 11.6223 0.032
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_440991.1_9 Forward -129 -110 12.9791 0.286
NP_440819.1_5 Forward -98 -90 7.8859 0.266
NP_440316.1_10 Reverse -109 -119 10.8948 0.218
NP_440316.1_10 Forward -181 -171 6.76487 0.253
NP_442663.1_1 Reverse -367 -386 7.86512 0.193
NP_440139.1_1 Forward -125 -106 5.50519 0.159
NP_442384.1_10 Forward -119 -106 8.37742 0.0656
NP_442384.1_10 Reverse -297 -310 3.26421 0.197
NP_442114.1_4 Forward -119 -108 11.3667 0.129
NP_440364.1_6 Forward -181 -168 15.3583 0.275
NP_440364.1_6 Reverse -290 -303 15.26 0.275
NP_442572.1_6 Reverse -95 -114 10.5209 0.229
NP_441018.1_3 Forward -182 -163 11.6017 0.286
NP_442790.1_4 Forward -128 -109 -6.78538 0.146
NP_442790.1_4 Reverse -101 -120 -15.4385 0.294
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_441689.1_5 Reverse -108 -118 8.53436 0.132
NP_441689.1_5 Forward -88 -78 5.87944 0.197
NP_442244.1_3 Forward -116 -97 7.66927 0.177
NP_440163.1_10 Reverse -8 -18 10.9931 0.18
NP_440344.1_10 Forward -126 -109 -11.9575 0.235
NP_440282.1_10 Reverse -293 -312 -10.3253 0.297
NP_440531.1_6 Reverse -96 -115 -3.04881 0.26
NP_441060.1_1 Forward -41 -22 19.9732 0.0991
NP_440189.1_10 Forward -130 -111 5.99764 0.279
NP_441965.1_3 Reverse -100 -119 5.89931 0.149
NP_441965.1_10 Forward -122 -106 6.84337 0.163
NP_442693.1_7 Reverse -193 -212 8.16093 0.275
NP_442102.1_4 Forward -89 -70 13.0775 0.222
NP_440297.1_9 Forward -118 -108 9.32148 0.0917
NP_440297.1_9 Reverse -111 -121 1.06167 0.282
NP_441592.1_4 Reverse -110 -129 -3.44213 0.281
NP_441103.1_1 Forward -400 -381 9.0459 0.253
NP_443036.1_9 Reverse -101 -120 15.3391 0.187
NP_442067.1_4 Reverse -99 -118 3.24438 0.289
NP_440999.1_1 Reverse -280 -299 12.9783 0.084
NP_440999.1_4 Reverse -106 -125 24.6805 0.00435
NP_440999.1_9 Reverse -106 -120 0.196253 0.191
NP_440888.1_2 Forward -119 -105 17.6002 0.00354
NP_442033.1_10 Forward -121 -102 -11.7019 0.257
NP_442512.1_3 Forward -109 -90 11.7008 0.242
NP_441543.1_2 Forward -118 -109 18.486 0.00236
NP_442845.1_2 Reverse -104 -118 7.9644 0.195
NP_442710.1_7 Forward -364 -345 -8.66439 0.299
NP_441469.1_8 Reverse -109 -118 16.126 0.00797
NP_441469.1_8 Forward -120 -111 12.6844 0.0995
NP_443064.1_6 Reverse -324 -334 8.59164 0.278
NP_442646.1_7 Forward -57 -38 8.45592 0.258
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_441462.1_2 Reverse -110 -120 17.8763 0.00406
NP_441462.1_2 Forward -119 -109 1.74999 0.0811
NP_441621.1_7 Forward -121 -107 4.42448 0.0934
NP_441621.1_7 Reverse -108 -122 -1.67204 0.184
NP_443062.1_1 Forward -119 -101 15.0789 0.0423
NP_441601.1_4 Forward -120 -101 -4.32711 0.293
NP_442204.1_1 Reverse -106 -117 7.92515 0.108
NP_442204.1_1 Forward -178 -167 0.845319 0.281
NP_442204.1_5 Reverse -100 -119 11.0125 0.0846
NP_440516.1_8 Reverse -110 -119 18.9776 0.00442
NP_440516.1_8 Forward -119 -110 7.07956 0.0867
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_440673.1_2 Forward -33 -14 13.121 0.126
NP_440673.1_3 Reverse -112 -119 13.1171 0.0426
NP_440673.1_3 Forward -117 -110 12.4288 0.0426
NP_440673.1_7 Reverse -99 -118 4.81767 0.185
NP_440865.1_9 Forward -125 -106 -8.06369 0.257
NP_441052.1_2 Forward -119 -109 11.0914 0.0285
NP_441052.1_2 Reverse -110 -120 0.668351 0.256
NP_441052.1_2 Forward -360 -350 0.471689 0.257
NP_442219.1_9 Reverse -111 -120 8.84951 0.0681
NP_442219.1_9 Forward -118 -109 8.35786 0.0681
NP_440436.1_4 Forward -118 -109 18.1905 0.00233
NP_440436.1_4 Reverse -111 -120 6.78414 0.147
NP_441884.1_8 Forward -120 -101 3.44104 0.0952
NP_441884.1_9 Forward -122 -103 -23.9933 0.284
NP_441336.1_3 Reverse -103 -117 14.7492 0.298
NP_442864.1_2 Reverse -166 -185 15.5357 0.214
NP_440314.1_9 Reverse -111 -130 0.58944 0.0952
NP_440314.1_9 Reverse -25 -44 -6.98204 0.236
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Forward -122 -109 15.0639 0.0646
NP_441004.1_1 Forward -125 -106 -9.24366 0.206
NP_441004.1_1 Forward -298 -279 -15.5368 0.275
NP_442366.1_3 Forward -120 -102 -2.0458 0.219
NP_440328.1_4 Reverse -104 -123 -0.295539 0.272
NP_442312.1_2 Forward -147 -128 18.1898 0.118
NP_443054.1_2 Reverse -108 -122 0.589577 0.258
NP_442430.1_10 Reverse -150 -169 12.29 0.241
NP_442430.1_10 Reverse -100 -119 10.9134 0.262
NP_441851.1_10 Reverse -109 -119 8.53483 0.114
NP_441851.1_10 Forward -120 -110 8.1415 0.122
NP_442208.1_5 Reverse -15 -34 -9.63698 0.295
NP_442622.1_8 Forward -119 -101 -8.63398 0.102
NP_442622.1_8 Forward -113 -95 -18.3687 0.205
NP_442622.1_8 Reverse -110 -128 -19.0571 0.296
NP_442011.1_1 Reverse -109 -128 -1.86883 0.271
NP_442515.1_1 Reverse -109 -123 6.19444 0.1
NP_441683.1_7 Reverse -125 -144 -13.0786 0.3
NP_441982.1_6 Reverse -64 -73 13.5358 0.274
NP_441982.1_6 Forward -65 -56 11.9124 0.288
NP_440463.1_1 Forward -131 -112 16.4207 0.288
NP_441349.1_10 Reverse -100 -119 -6.58872 0.233
NP_440432.1_9 Reverse -111 -126 0.373221 0.159
NP_439960.1_6 Reverse -165 -184 17.5024 0.107
NP_439960.1_10 Reverse -97 -115 5.13236 0.159
NP_440474.1_8 Forward -118 -104 6.88214 0.215
NP_440933.1_1 Forward -116 -97 9.93088 0.289
NP_442450.1_5 Forward -121 -111 10.4031 0.115
NP_442450.1_5 Reverse -108 -118 9.32148 0.115
NP_442168.1_5 Reverse -161 -180 -2.16383 0.264
NP_440588.1_2 Reverse -101 -120 16.7157 0.0108
NP_440588.1_2 Forward -128 -109 1.76941 0.13
NP_441570.1_1 Forward -119 -101 -6.96235 0.0829
NP_441078.1_4 Reverse -110 -119 9.93116 0.0203
NP_441078.1_4 Forward -119 -110 9.83282 0.0226
NP_442348.1_2 Forward -42 -33 7.57121 0.28
NP_440707.1_6 Reverse -102 -121 12.6833 0.208
NP_442443.1_1 Reverse -102 -121 -3.73712 0.267
NP_440526.1_3 Reverse -111 -122 2.22148 0.267
NP_440526.1_3 Forward -22 -11 2.22148 0.267
NP_441432.1_8 Reverse -109 -118 8.25953 0.0755
NP_441432.1_8 Forward -150 -141 5.40793 0.158
NP_441432.1_9 Forward -197 -184 8.30749 0.29
NP_442320.1_8 Reverse -104 -118 5.1128 0.0437
NP_442320.1_8 Forward -125 -111 -3.73699 0.131
NP_441732.1_2 Reverse -106 -122 -7.51295 0.0859
NP_440760.1_1 Reverse -110 -129 -13.7669 0.112
NP_442797.1_6 Forward -117 -98 12.5881 0.228
NP_442797.1_7 Forward -120 -102 12.7038 0.144
NP_440199.1_10 Reverse -107 -117 13.2547 0.108
NP_441057.1_4 Reverse -94 -112 1.19912 0.253
NP_442353.1_4 Reverse -150 -169 1.86696 0.24
NP_443011.1_4 Forward -181 -162 10.7175 0.216
NP_440713.1_4 Reverse -100 -119 1.47442 0.286
NP_442489.1_7 Reverse -110 -119 10.4228 0.0151
NP_442489.1_7 Forward -119 -110 10.3245 0.0193
NP_441706.1_2 Reverse -110 -129 24.2872 0.0241
NP_440559.1_1 Reverse -111 -120 9.14451 0.0586
NP_440559.1_1 Forward -118 -109 8.75118 0.0586
NP_441659.2_8 Reverse -110 -120 9.81313 0.0269
NP_441659.2_8 Forward -119 -109 2.43831 0.2
NP_442913.1_9 Forward -275 -256 9.63589 0.22
NP_441040.1_2 Reverse -102 -121 -8.85033 0.236
NP_442008.1_2 Forward -122 -103 2.3594 0.289
NP_440779.1_5 Reverse -110 -127 -13.7275 0.224
NP_442346.1_5 Forward -120 -110 14.1397 0.0164
NP_440545.1_3 Forward -123 -106 4.85706 0.0661
NP_440831.1_3 Reverse -101 -120 19.5896 0.0431
NP_441923.1_8 Forward -258 -244 19.0758 0.138
NP_440486.1_6 Forward -307 -288 12.5858 0.207
NP_440486.1_6 Forward -56 -37 5.89931 0.287
NP_440459.1_2 Forward -121 -104 11.7402 0.166
NP_440010.1_10 Reverse -285 -304 7.57094 0.226
NP_442603.1_7 Forward -119 -105 12.192 0.102
NP_442603.1_7 Forward -306 -292 8.25877 0.178
NP_442603.1_7 Reverse -110 -124 7.86545 0.193
NP_441888.1_7 Reverse -105 -119 4.12949 0.225
NP_440449.1_6 Reverse -102 -120 5.92152 0.266
NP_441948.1_4 Reverse -103 -121 -3.12744 0.186
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_440671.1_4 Reverse -104 -118 12.1926 0.114
NP_442140.1_3 Reverse -111 -121 16.598 0.0255
NP_442140.1_3 Forward -118 -108 8.33817 0.119
NP_441696.1_6 Forward -118 -99 9.0459 0.212
NP_440875.1_9 Reverse -173 -183 12.4602 0.117
NP_441813.1_5 Reverse -108 -118 17.188 0.00979
NP_441813.1_5 Forward -121 -111 8.92815 0.0347
NP_440594.1_3 Forward -119 -101 23.4219 0.0333
NP_441259.1_8 Reverse -168 -187 10.2251 0.286
NP_440590.1_4 Forward -118 -105 13.3923 0.013
NP_440567.1_1 Forward -118 -104 14.6509 0.0187
NP_440567.1_1 Reverse -111 -125 7.37441 0.0726
NP_440719.1_9 Reverse -166 -185 17.9932 0.284
NP_442497.1_10 Reverse -111 -120 10.8161 0.0087
NP_442497.1_10 Forward -118 -109 10.4228 0.0087
NP_440821.1_4 Reverse -108 -118 19.0562 0.00399
NP_440821.1_4 Forward -121 -111 17.188 0.00705
NP_441239.1_9 Forward -121 -109 16.7552 0.0157
NP_441239.1_9 Reverse -108 -120 7.31547 0.165
NP_441009.1_7 Forward -114 -95 9.93088 0.249
NP_441727.1_3 Reverse -133 -152 4.62101 0.262
NP_441892.1_1 Reverse -101 -118 9.47861 0.0722
NP_440665.1_1 Forward -306 -287 -10.6203 0.244
NP_440665.1_1 Reverse -98 -117 -16.8151 0.293
NP_440796.1_3 Reverse -103 -121 18.8979 0.187
NP_441508.1_4 Reverse -66 -80 14.3354 0.283
NP_441017.1_6 Reverse -106 -120 12.8803 0.217
NP_442216.1_4 Reverse -34 -42 8.1805 0.255
NP_440354.1_7 Reverse -97 -115 9.45892 0.224
NP_440546.1_4 Reverse -110 -120 14.0213 0.0459
NP_440546.1_4 Forward -119 -109 9.17338 0.151
NP_441230.1_5 Forward -124 -105 2.65439 0.212
NP_440462.1_6 Reverse -108 -118 15.418 0.0142
NP_440462.1_6 Forward -121 -111 9.41981 0.044
NP_442340.1_3 Forward -235 -216 1.37609 0.144
NP_440868.1_4 Reverse -106 -118 11.2487 0.0327
NP_440868.1_4 Forward -123 -111 1.7106 0.174
NP_440812.1_10 Reverse -299 -312 15.8506 0.259
NP_442402.1_4 Forward -35 -16 -0.0996487 0.188
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_441811.1_3 Reverse -96 -110 19.7641 0.28
NP_442829.1_2 Reverse -140 -156 8.14109 0.287
NP_441926.1_3 Reverse -110 -126 5.17175 0.174
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_442053.1_1 Reverse -110 -119 17.601 0.00138
NP_442053.1_1 Forward -119 -110 16.2243 0.00451
NP_440505.1_3 Reverse -108 -118 13.8447 0.0247
NP_441102.1_1 Forward -305 -286 4.22769 0.272
NP_442532.1_7 Reverse -110 -124 12.0943 0.114
NP_440914.1_1 Reverse -110 -120 7.24882 0.242
NP_440914.1_1 Forward -119 -109 6.07773 0.297
NP_441011.1_8 Forward -118 -109 16.9127 0.00602
NP_441011.1_8 Reverse -111 -120 12.7828 0.0397
NP_442533.1_1 Forward -58 -39 -16.1268 0.263
NP_442533.1_6 Reverse -110 -119 7.86621 0.0862
NP_442533.1_6 Forward -119 -110 7.37455 0.0898
NP_441482.1_7 Reverse -104 -118 -8.65353 0.193
NP_439944.1_9 Forward -118 -108 10.3048 0.0887
NP_439944.1_9 Reverse -111 -121 8.4365 0.108
NP_441697.1_5 Reverse -345 -364 -9.59736 0.271
NP_441028.1_6 Reverse -90 -100 5.19112 0.265
NP_440116.1_8 Reverse -111 -130 -9.53865 0.281
NP_441527.1_4 Reverse -368 -387 3.29405 0.118
NP_440007.1_9 Reverse -100 -114 2.94952 0.277
NP_440007.1_9 Reverse -125 -139 0.491246 0.297
NP_441106.1_1 Reverse -109 -118 18.191 0.0028
NP_441420.1_1 Reverse -109 -128 -3.93378 0.292
NP_442306.1_10 Reverse -105 -124 -20.4534 0.21
NP_440797.1_2 Reverse -99 -118 11.7906 0.292
NP_441186.1_5 Reverse -368 -387 16.7584 0.193
NP_441286.1_1 Reverse -109 -121 13.707 0.00583
NP_441286.1_1 Forward -120 -108 -4.18925 0.152
NP_440670.1_8 Reverse -110 -119 9.04618 0.0606
NP_440670.1_8 Forward -119 -110 8.75118 0.0606
NP_442908.1_8 Forward -187 -168 12.6841 0.266
NP_440103.1_3 Forward -384 -374 15.4857 0.286
NP_440886.1_7 Reverse -109 -119 16.4991 0.0104
NP_440886.1_7 Forward -120 -110 8.04271 0.0805
NP_440886.1_7 Reverse -284 -294 4.60114 0.227
NP_442072.1_9 Forward -120 -102 -13.7472 0.121
NP_442401.1_2 Forward -150 -131 7.27514 0.269
NP_440907.2_8 Reverse -111 -121 10.3043 0.103
NP_440907.2_8 Forward -118 -108 7.84605 0.117
NP_442264.1_2 Forward -123 -106 5.54538 0.275
NP_441021.1_1 Reverse -111 -130 -2.0655 0.131
NP_441021.1_1 Forward -22 -3 -10.7186 0.246
NP_441463.1_3 Forward -129 -110 -5.80207 0.232
NP_441463.1_3 Reverse -100 -119 -8.752 0.273
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442365.1_7 Reverse -106 -125 -2.45882 0.2
NP_442365.1_7 Reverse -100 -119 -5.21209 0.262
NP_440107.1_5 Reverse -103 -122 -6.49039 0.254
NP_442794.1_1 Reverse -293 -305 3.18557 0.286
NP_442615.1_1 Forward -128 -110 -6.37237 0.244
NP_441962.1_4 Forward -118 -99 -12.3902 0.256
NP_441962.1_4 Forward -286 -267 -12.8819 0.265
NP_441962.1_9 Reverse -95 -114 5.01433 0.286
NP_440387.1_1 Reverse -110 -126 0.648521 0.122
NP_440387.1_1 Forward -119 -103 -2.20308 0.147
NP_441431.1_2 Reverse -107 -121 6.98048 0.255
NP_441836.1_2 Forward -119 -100 -1.37718 0.217
NP_440634.1_2 Reverse -285 -304 16.4207 0.286
NP_441993.1_1 Reverse -104 -123 1.94669 0.267
NP_440143.1_1 Reverse -191 -210 12.6841 0.284
NP_440114.1_10 Reverse -110 -124 11.0127 0.127
NP_442090.1_2 Forward -73 -54 11.0289 0.239
NP_441206.1_4 Forward -205 -186 -5.31042 0.263
NP_441510.2_7 Reverse -104 -118 10.717 0.28
NP_440293.1_3 Forward -293 -274 -5.01543 0.269
NP_440766.1_4 Reverse -106 -120 16.8142 0.0256
NP_441237.1_9 Reverse -111 -121 16.893 0.01
NP_441979.1_5 Forward -125 -106 -1.96717 0.147
NP_440457.1_1 Reverse -106 -118 8.88877 0.101
NP_440457.1_1 Reverse -10 -22 0.727295 0.25
NP_440798.1_6 Forward -118 -105 6.1158 0.14
NP_440801.1_10 Reverse -106 -125 7.57094 0.272
NP_440942.1_6 Forward -32 -13 6.68515 0.259
NP_440473.1_9 Forward -130 -111 4.12936 0.0985
NP_442509.1_9 Reverse -110 -120 15.9091 0.00953
NP_442509.1_9 Forward -119 -109 12.4676 0.09
NP_442439.1_8 Reverse -170 -189 7.66927 0.275
NP_442514.1_5 Forward -314 -295 -8.94939 0.292
NP_440554.1_4 Forward -118 -108 14.6313 0.02
NP_441845.1_6 Forward -131 -113 1.88744 0.27
NP_441885.1_5 Reverse -110 -120 2.24165 0.0822
NP_441885.1_5 Forward -119 -109 1.65166 0.106
NP_442341.1_7 Forward -307 -293 10.9143 0.0591
NP_442341.1_7 Forward -120 -106 7.27608 0.109
NP_441173.1_9 Forward -370 -362 10.6388 0.261
NP_440119.1_1 Forward -141 -125 2.02515 0.232
NP_442395.2_4 Forward -120 -101 5.30853 0.164
NP_442395.2_4 Reverse -109 -128 4.03023 0.188
NP_443000.1_7 Reverse -108 -118 8.73149 0.0437
NP_440507.2_3 Forward -128 -109 13.175 0.145
NP_440507.2_3 Forward -122 -103 11.7 0.173
NP_441842.1_10 Reverse -103 -117 11.2093 0.138
NP_440275.1_3 Forward -121 -111 10.8948 0.0398
NP_440275.1_3 Reverse -108 -118 8.4365 0.0602
NP_442932.1_9 Reverse -17 -36 12.7825 0.175
NP_440091.1_1 Reverse -106 -118 8.29878 0.0653
NP_440679.1_10 Reverse -103 -122 -12.9802 0.215
NP_443010.1_10 Reverse -107 -124 7.79575 0.165
NP_442451.1_2 Reverse -102 -121 0.196116 0.153
NP_439962.1_4 Forward -121 -102 -6.58872 0.283
NP_439962.1_4 Reverse -110 -129 -6.88371 0.285
NP_440804.1_7 Forward -382 -365 8.98622 0.261
NP_440149.1_8 Forward -119 -100 -2.75381 0.175
NP_441105.1_3 Reverse -99 -118 8.75091 0.0472
NP_440216.1_1 Forward -119 -105 -1.27871 0.0303
NP_440216.1_1 Reverse -110 -124 -4.4253 0.111
NP_440216.1_6 Reverse -103 -119 6.9417 0.189
NP_440172.1_1 Reverse -110 -120 17.2863 0.00544
NP_440172.1_1 Forward -149 -139 2.63497 0.274
NP_442015.1_10 Reverse -106 -119 9.85238 0.0433
NP_442015.1_10 Reverse -293 -306 1.69091 0.204
NP_442015.1_10 Forward -15 -2 -1.06236 0.293
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_441226.1_7 Forward -112 -105 9.77352 0.131
NP_441226.1_7 Reverse -104 -111 6.82361 0.246
NP_441111.1_7 Forward -118 -110 18.7023 0.00294
NP_441111.1_7 Reverse -111 -119 8.96754 0.0463
NP_442379.1_10 Reverse -103 -120 -2.91109 0.245
NP_441766.1_2 Forward -119 -110 18.2893 0.00297
NP_441766.1_2 Reverse -110 -119 9.14451 0.0337
NP_442417.1_5 Forward -119 -105 12.7826 0.0924
NP_440416.1_1 Reverse -110 -129 -14.1602 0.284
NP_440416.1_9 Reverse -103 -122 -14.3569 0.176
NP_440416.1_9 Forward -120 -101 -17.2085 0.234
NP_442116.1_2 Reverse -148 -167 11.995 0.289
NP_442116.1_2 Reverse -375 -394 11.3067 0.289
NP_441940.1_4 Reverse -270 -289 6.19431 0.294
NP_442403.1_8 Forward -117 -98 0.392778 0.241
NP_440591.1_9 Forward -126 -108 12.1139 0.0935
NP_442154.1_1 Reverse -12 -30 -3.71743 0.125
NP_442154.1_1 Forward -179 -161 -15.9105 0.228
NP_440261.1_5 Forward -118 -105 -2.63565 0.0924
NP_440261.1_5 Reverse -111 -124 -10.5021 0.201
NP_440261.1_7 Forward -114 -95 -5.01543 0.217
NP_440988.1_10 Forward -115 -101 14.8705 0.126
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGCTGGCAAAGCTTGTTTTTATTGGCGTATTTAACAAAAGACTATGGACATTTTGACATTAGGTTGGGTAAGCGTGTTAGTTCTGTTCACCTGGTCCATCAGCATGGTGGTATGGGGTCGGAACGGCTTCTAGGATTAAACCTGGATTTCCCGTTGTTTAAGAGTCTTTGATACCGTGGAAGCAACTCCTACTCCTGTCCTCAACACCCTTTTTTTAGCGGCCCTGGTGATGCTAGTGCTTGTTAGTGGTGGCATTCTCTACCTCACCACCCTGGAATGGCGCGATCGCCGTCGGCAGGATCGGGATAAAAAAATGGGTCGCTAGTTTTTTGAGTAGTTGAAAAGTTTACGGACGCGGGGGAATTTTGCCCTCTTGTGCCACCACCCCTGTGATAACTT

CDS

ATGGGTCTTTCCCGTTTACCGGTGATTGGGTTATTTATTACCCTGGTCACCATAGCTTTTTTGCTGGTTGCCAACTTTGACCAAAATCCAGTCCCGGTTAATCTGGCCAAGGATGCCCCCACCCAAAGCTCCTCTCCTGGGTTGGTTATTGTGGCGGCGGGAGATATTGCCTGTGCCCCCGAAGATCCCGGCTTTAATAACAGTTTAGGTACAGCAGACCGTTGCCAGATGGCCGCCACAGCTAATTTGGTTGCTAGCGCTAATCCTGATCTAGTTTTACCGCTAGGGGATAACCAGTACGAACGGGGAGAATTGGCTAATTACCAAGCTTCCTATCAACCCACCTGGGGAAAATTCGATGCCATCAGCCGCCCTGTGCCAGGTAACCATGAATATTACGGCCCCGGCAAAGATGCGGCGGACTACTTTGATTATTTTGGCCAACTAGCCGGCGATCGCCAAAAGGGCTATTACAGCTACGACCAGGGGGACTGGCATTTTATTGCCCTCAATTCCAACTGCCAATACATTGGCGGTTGCGAAATGGGATCGGCCCAACAGGAATGGCTCAGGCAAGATTTAGCCGAAAACAACAAAGTCTGTACCCTAGCCTATTGGCACCACCCCCTTTATTCCTCTGGTGTGCACGGTAACCAAAAGCAAATGGCGGACCTATGGCAGACCCTCTACGATGGCGGTGCGGAATTGGTGCTATCGGGGCACGACCACCTGTACGAAAGATTTGCCCCCCAAAATGCCCAGGGTGAATTGGATAGGGAAAAGGGGCTGAGGCAATTTGTCATTGGCACCGGCGGCAAAAGTCTTTATCCTTTCAAAACCGTGCGCCCCAACAGTGAAGTTCAGGCAATGGGAGTTTATGGAGTGCTGAAAATGGAACTCCAATCCAACAGCTACCGCTGGCAATTCCTAACCGCCAACACCGACGAATTCAATGAACAGGGGAAGGATTTATGTCATTAA

Protein

MGLSRLPVIGLFITLVTIAFLLVANFDQNPVPVNLAKDAPTQSSSPGLVIVAAGDIACAPEDPGFNNSLGTADRCQMAATANLVASANPDLVLPLGDNQYERGELANYQASYQPTWGKFDAISRPVPGNHEYYGPGKDAADYFDYFGQLAGDRQKGYYSYDQGDWHFIALNSNCQYIGGCEMGSAQQEWLRQDLAENNKVCTLAYWHHPLYSSGVHGNQKQMADLWQTLYDGGAELVLSGHDHLYERFAPQNAQGELDREKGLRQFVIGTGGKSLYPFKTVRPNSEVQAMGVYGVLKMELQSNSYRWQFLTANTDEFNEQGKDLCH