Your browser is old and dusty. Try Google Chrome!

Details for sll0221

ORF sll0221
Accession NP_440046.1
Symbol
Category bacterioferritin comigratory protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Forward -121 -114 12.9205 0.23
NP_441623.1_1 Reverse -114 -132 12.6055 0.0833
NP_441818.1_9 Forward -123 -104 -0.39387 0.196
NP_442752.1_4 Reverse -393 -400 13.8055 0.0199
NP_440061.1_9 Forward -193 -179 6.58715 0.239
NP_440061.1_9 Forward -172 -158 5.40719 0.286
NP_441859.1_3 Forward -171 -152 4.81688 0.213
NP_441859.1_3 Forward -238 -219 3.53858 0.239
NP_440304.1_4 Forward -371 -361 3.71661 0.293
NP_440856.1_7 Forward -267 -248 -9.63698 0.294
NP_441083.1_5 Reverse -318 -328 1.94665 0.197
NP_441083.1_5 Reverse -182 -192 -1.10161 0.295
NP_441738.1_2 Forward -400 -393 15.28 0.0102
NP_442570.1_3 Reverse -336 -355 0.196116 0.208
NP_441716.1_1 Forward -225 -211 3.73617 0.259
NP_442111.1_4 Forward -192 -178 1.86788 0.293
NP_440747.1_10 Reverse -293 -305 -2.51763 0.0509
NP_440747.1_10 Reverse -179 -191 -11.5641 0.125
NP_440747.1_10 Reverse -336 -348 -12.3507 0.27
NP_441130.1_7 Forward -197 -183 15.9285 0.287
NP_443018.1_3 Forward -311 -304 7.11894 0.16
NP_441634.1_8 Forward -398 -384 -0.787057 0.268
NP_440376.1_1 Forward -305 -296 5.60459 0.125
NP_440376.1_1 Forward -180 -171 3.53964 0.2
NP_440376.1_1 Reverse -79 -88 3.04799 0.21
NP_441013.1_2 Reverse -328 -346 3.46073 0.23
NP_441388.1_10 Forward -359 -342 20.7438 0.0648
NP_441682.1_6 Forward -293 -274 12.3892 0.291
NP_442296.1_9 Forward -311 -292 -2.26216 0.223
NP_440141.1_9 Reverse -74 -93 -2.45882 0.276
NP_441414.1_7 Forward -245 -226 9.73422 0.297
NP_440800.1_2 Forward -172 -153 13.9926 0.299
NP_441487.1_9 Forward -99 -80 6.29264 0.131
NP_440203.1_5 Forward -399 -389 12.0743 0.166
NP_440369.1_5 Forward -369 -350 9.0459 0.276
NP_443055.1_3 Reverse -330 -349 10.7406 0.28
NP_443055.1_6 Reverse -379 -397 6.70489 0.165
NP_442002.1_1 Reverse -149 -167 -9.42063 0.281
NP_441294.1_7 Forward -309 -295 12.9942 0.0767
NP_441646.1_7 Reverse -291 -305 15.1426 0.247
NP_442438.1_10 Reverse -291 -305 0.589577 0.221
NP_441752.1_2 Forward -84 -65 14.4541 0.157
NP_441550.1_8 Forward -329 -319 7.45273 0.159
NP_440206.1_4 Reverse -110 -129 -0.0996487 0.289
NP_440206.1_4 Forward -298 -279 -1.77127 0.293
NP_441725.1_5 Forward -224 -214 -0.216628 0.241
NP_440983.1_9 Forward -346 -327 5.60432 0.282
NP_441514.1_6 Reverse -214 -221 12.8221 0.252
NP_442215.1_2 Forward -193 -177 -6.13632 0.264
NP_440929.1_8 Forward -191 -182 5.89959 0.11
NP_441751.2_8 Forward -304 -290 -4.32697 0.17
NP_442926.1_3 Forward -236 -217 2.16274 0.295
NP_442142.1_4 Forward -345 -332 2.28034 0.295
NP_442476.1_6 Reverse -217 -231 3.73617 0.154
NP_442476.1_6 Forward -337 -323 -0.000409212 0.28
NP_443009.1_5 Reverse -215 -226 7.43299 0.129
NP_440279.1_8 Forward -233 -214 13.5691 0.242
NP_441448.1_1 Forward -140 -121 5.50599 0.261
NP_441198.1_8 Reverse -214 -224 11.1228 0.222
NP_441015.1_10 Forward -134 -115 -11.5053 0.298
NP_441673.1_1 Reverse -182 -191 -7.76842 0.168
NP_441673.1_1 Forward -191 -182 -8.06341 0.254
NP_441876.1_9 Forward -125 -115 11.091 0.28
NP_442490.1_9 Reverse -381 -400 -9.047 0.299
NP_442361.1_3 Reverse -387 -400 8.37742 0.285
NP_442808.1_1 Reverse -170 -180 3.71617 0.227
NP_440918.1_2 Reverse -337 -356 22.8122 0.0564
NP_442505.1_1 Reverse -187 -206 19.3997 0.228
NP_441937.1_5 Forward -311 -292 3.24438 0.278
NP_440601.1_1 Reverse -343 -362 17.5024 0.253
NP_440385.1_8 Forward -373 -354 15.0396 0.198
NP_441114.1_3 Forward -361 -352 7.27622 0.247
NP_440558.1_2 Forward -303 -284 -0.787193 0.204
NP_440558.1_2 Forward -351 -332 -2.85214 0.231
NP_441878.1_6 Forward -306 -296 -7.19813 0.21
NP_441036.1_8 Reverse -181 -191 13.353 0.0482
NP_442830.1_5 Forward -300 -286 -1.47595 0.299
NP_442830.1_5 Forward -226 -212 -1.86927 0.3
NP_442347.1_2 Reverse -162 -171 6.68623 0.156
NP_440151.1_5 Forward -186 -167 4.42435 0.262
NP_441633.1_3 Reverse -104 -117 -5.48725 0.236
NP_442590.1_9 Reverse -337 -356 4.03102 0.277
NP_442590.1_10 Reverse -327 -346 4.916 0.27
NP_442998.1_5 Reverse -200 -210 7.05986 0.3
NP_442998.1_10 Forward -400 -393 15.5754 0.0102
NP_442998.1_10 Forward -196 -189 7.21728 0.144
NP_440899.1_5 Reverse -110 -129 5.99764 0.242
NP_440640.1_6 Forward -267 -248 3.73603 0.213
NP_442334.1_2 Forward -337 -320 -8.61428 0.297
NP_442961.1_4 Forward -269 -250 5.80098 0.227
NP_441559.1_8 Forward -229 -215 11.701 0.0574
NP_441559.1_8 Reverse -334 -348 -6.19526 0.275
NP_441559.1_8 Forward -39 -25 -7.08024 0.283
NP_441559.1_8 Reverse -210 -224 -7.47356 0.294
NP_442866.1_1 Forward -230 -211 -2.75381 0.214
NP_442866.1_1 Reverse -328 -347 -9.44032 0.293
NP_441464.1_1 Reverse -121 -140 7.37428 0.262
NP_442993.1_1 Reverse -303 -319 -12.5278 0.274
NP_442386.1_9 Reverse -386 -395 12.5856 0.058
NP_442386.1_9 Forward -339 -330 10.324 0.132
NP_442386.1_9 Forward -397 -388 9.5374 0.159
NP_442386.1_9 Reverse -328 -337 8.65242 0.188
NP_440570.1_5 Forward -142 -123 -1.08219 0.266
NP_442240.1_2 Forward -190 -171 -20.8467 0.297
NP_442959.1_4 Forward -155 -136 4.62101 0.27
NP_441912.1_3 Forward -185 -166 7.66927 0.27
NP_440684.1_9 Forward -197 -183 6.78443 0.29
NP_441262.1_3 Reverse -393 -400 14.7888 0.0223
NP_440027.1_3 Forward -348 -330 3.65664 0.267
NP_439937.1_9 Forward -171 -154 -9.20492 0.183
NP_440626.1_1 Reverse -183 -202 9.7334 0.256
NP_440439.1_1 Reverse -179 -192 -2.144 0.298
NP_442239.1_8 Forward -121 -102 9.93088 0.249
NP_439943.1_4 Forward -129 -110 5.99764 0.275
NP_441572.1_1 Forward -125 -106 -3.83545 0.217
NP_442384.1_10 Forward -225 -212 4.34585 0.16
NP_440399.1_1 Forward -234 -215 6.4893 0.3
NP_442262.1_10 Forward -311 -304 8.20058 0.25
NP_440163.1_10 Reverse -390 -400 12.4681 0.159
NP_440344.1_10 Forward -312 -295 -11.4659 0.215
NP_440282.1_10 Reverse -131 -150 6.29264 0.125
NP_440531.1_6 Forward -199 -180 -3.3438 0.265
NP_442280.1_10 Reverse -329 -347 7.88944 0.268
NP_440999.1_9 Forward -229 -215 -1.47537 0.239
NP_439969.1_3 Reverse -166 -185 -0.39387 0.271
NP_442277.1_4 Forward -357 -338 1.76863 0.266
NP_441543.1_3 Reverse -168 -182 9.83206 0.226
NP_441551.1_5 Reverse -329 -345 15.2008 0.0915
NP_441469.1_8 Reverse -328 -337 5.70292 0.257
NP_441469.1_8 Forward -89 -80 5.40793 0.272
NP_442315.1_2 Reverse -74 -86 18.1319 0.149
NP_442204.1_1 Reverse -389 -400 -0.0396598 0.285
NP_442204.1_5 Forward -315 -296 0.982764 0.249
NP_441560.1_3 Forward -356 -338 5.82068 0.286
NP_441560.1_3 Forward -347 -329 5.23069 0.298
NP_442120.1_10 Reverse -354 -373 -8.45701 0.237
NP_440673.1_3 Forward -400 -393 12.4288 0.0426
NP_441884.1_9 Reverse -117 -136 -14.1602 0.138
NP_441884.1_9 Reverse -291 -310 -22.5183 0.281
NP_441004.1_2 Forward -260 -241 -4.72043 0.296
NP_441004.1_5 Forward -118 -104 8.65272 0.272
NP_442813.1_4 Reverse -63 -82 -2.26216 0.264
NP_441115.1_4 Forward -343 -325 10.2448 0.183
NP_441851.1_9 Reverse -179 -198 7.37428 0.282
NP_441501.1_6 Reverse -323 -342 12.5858 0.292
NP_442515.1_1 Reverse -258 -272 4.62115 0.107
NP_442515.1_1 Reverse -78 -92 -1.96703 0.268
NP_441982.1_6 Forward -83 -74 11.1485 0.288
NP_440463.1_8 Reverse -337 -356 6.14452 0.271
NP_441046.1_2 Forward -374 -355 3.73603 0.231
NP_441107.1_1 Reverse -323 -342 17.404 0.247
NP_442243.1_1 Reverse -176 -194 7.19654 0.178
NP_440078.1_10 Forward -191 -172 7.96426 0.216
NP_440078.1_10 Forward -318 -299 3.24438 0.269
NP_441078.1_4 Reverse -296 -305 -1.18024 0.237
NP_442348.1_2 Reverse -2 -11 7.57121 0.28
NP_442443.1_1 Forward -137 -118 -6.58872 0.295
NP_441432.1_8 Reverse -338 -347 10.0295 0.0681
NP_443024.1_3 Forward -252 -242 10.3048 0.289
NP_441732.1_2 Forward -202 -186 -17.0511 0.231
NP_440629.1_4 Forward -161 -142 8.94757 0.26
NP_440199.1_10 Reverse -390 -400 7.64985 0.231
NP_442751.1_2 Forward -349 -330 2.26028 0.295
NP_442489.1_2 Reverse -130 -149 5.60432 0.192
NP_442489.1_2 Reverse -376 -395 4.12936 0.224
NP_441830.1_2 Reverse -330 -349 -4.72043 0.275
NP_440757.1_7 Reverse -304 -322 -3.32411 0.288
NP_442913.1_10 Forward -314 -295 -4.52377 0.24
NP_441040.1_2 Forward -193 -174 1.17943 0.119
NP_440708.1_6 Reverse -172 -191 -9.83364 0.274
NP_440442.1_3 Reverse -386 -400 19.2725 0.117
NP_442776.1_8 Reverse -175 -194 23.1063 0.0177
NP_440315.1_3 Forward -251 -232 13.7658 0.294
NP_441653.1_2 Forward -349 -330 5.17239 0.248
NP_440847.1_3 Reverse -122 -136 11.012 0.275
NP_441050.1_5 Forward -253 -235 -1.06249 0.26
NP_441050.1_5 Reverse -233 -251 -2.43913 0.283
NP_440170.1_6 Reverse -291 -310 12.9791 0.283
NP_442404.1_9 Forward -167 -153 10.5204 0.263
NP_442404.1_9 Reverse -219 -233 9.93039 0.263
NP_441239.1_9 Reverse -288 -300 7.02048 0.173
NP_441239.1_9 Forward -314 -302 4.95553 0.234
NP_442568.1_8 Forward -353 -339 12.0943 0.257
NP_442270.1_9 Reverse -349 -368 -6.49039 0.207
NP_441508.1_4 Reverse -106 -120 13.8579 0.29
NP_441769.1_1 Forward -233 -214 8.16093 0.256
NP_442216.1_4 Forward -223 -215 8.37716 0.255
NP_443035.1_10 Reverse -326 -343 15.2801 0.174
NP_443035.1_10 Forward -136 -119 13.2152 0.179
NP_440546.1_4 Forward -122 -112 7.23423 0.252
NP_440546.1_7 Forward -261 -251 14.9263 0.279
NP_441230.1_5 Forward -190 -171 -0.0988766 0.277
NP_441230.1_9 Reverse -198 -217 17.2074 0.257
NP_440675.1_1 Forward -321 -302 5.01433 0.23
NP_441184.1_5 Reverse -279 -298 9.53756 0.182
NP_441474.1_1 Reverse -104 -123 -2.16459 0.272
NP_441084.1_6 Forward -344 -330 11.4772 0.201
NP_440696.1_3 Reverse -329 -347 10.5406 0.144
NP_442380.1_10 Reverse -329 -347 7.00065 0.298
NP_440160.1_3 Reverse -168 -187 11.995 0.209
NP_440505.1_3 Reverse -294 -304 4.69992 0.272
NP_440505.1_7 Reverse -335 -354 8.16093 0.162
NP_441408.2_7 Forward -350 -331 11.5042 0.0871
NP_442931.1_8 Reverse -237 -256 5.01433 0.232
NP_442533.1_6 Forward -299 -290 3.44131 0.212
NP_442533.1_6 Forward -144 -135 2.65466 0.246
NP_442533.1_6 Reverse -182 -191 2.16301 0.27
NP_441482.1_7 Forward -333 -319 -11.5051 0.268
NP_439944.1_9 Reverse -340 -350 8.4365 0.108
NP_441028.1_6 Forward -242 -232 14.6309 0.158
NP_440115.1_6 Reverse -390 -400 9.41981 0.115
NP_441972.1_5 Reverse -377 -396 -6.49039 0.231
NP_439903.1_6 Forward -372 -353 -0.886293 0.287
NP_441286.1_1 Reverse -295 -307 -6.35254 0.26
NP_441930.1_3 Reverse -203 -222 3.54155 0.281
NP_441403.1_4 Reverse -76 -94 5.82068 0.293
NP_440907.2_1 Reverse -318 -337 13.0775 0.28
NP_442211.1_3 Forward -338 -319 7.66653 0.275
NP_442794.1_1 Reverse -335 -347 5.34885 0.225
NP_441962.1_4 Reverse -214 -233 -7.86702 0.195
NP_441488.1_7 Forward -135 -116 1.76941 0.285
NP_441993.1_1 Reverse -339 -358 1.16703 0.284
NP_441993.1_1 Forward -129 -110 0.972113 0.288
NP_440293.1_3 Reverse -331 -350 -2.16383 0.239
NP_439910.1_2 Reverse -268 -285 -22.6756 0.285
NP_441801.1_4 Reverse -109 -119 2.7333 0.262
NP_440942.1_6 Forward -314 -295 5.2102 0.269
NP_441984.1_3 Forward -133 -115 7.68896 0.243
NP_441885.1_5 Reverse -182 -192 -0.216628 0.189
NP_442341.1_7 Forward -171 -157 8.25939 0.0898
NP_442341.1_7 Forward -105 -91 4.81781 0.177
NP_442341.1_7 Reverse -215 -229 1.76955 0.281
NP_442341.1_9 Reverse -180 -194 13.7653 0.0763
NP_440119.1_1 Reverse -123 -139 9.00665 0.14
NP_440191.1_4 Forward -241 -231 14.1177 0.281
NP_440679.1_10 Forward -400 -381 -17.7985 0.275
NP_443010.1_10 Forward -228 -211 4.89674 0.216
NP_440175.1_7 Forward -185 -167 8.67997 0.292
NP_441105.1_3 Forward -155 -136 -9.63698 0.292
NP_440216.1_1 Forward -191 -177 -3.93365 0.0918
NP_440216.1_1 Reverse -171 -185 -12.0951 0.24
NP_440216.1_1 Reverse -79 -93 -12.4884 0.274
NP_442417.1_5 Forward -191 -177 5.50613 0.258
NP_440416.1_9 Reverse -322 -341 -18.8801 0.266
NP_440416.1_9 Forward -199 -180 -20.8467 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGATCGCCATGCCGGGTTCAGTGCATGACAAGGTAATTTCTAATGCCCAGGAAGCCAAAGCCAGGGATGCCAGGCTCATCGGGGTTACTCCCATGGACGACAGCCAGGCCCGTTCTGTGTTCGATGATTTATTGTTAGTGCCCCACGTGGAGGAAATGCTTTCCCCTATTGTGGCAGTGATTCCCCTGCAACTTTTGTCCTACCATATTGCCGCCCGCCGGGGGTTAGACGTGGATCAACCCCGTAATTTGGCTAAGTCCGTCACCGTGGAGTAGTTGGCCCCTGGGTTGTTGCAGGTCAATAACAGCAGCCTGCTGTCCCCAAAAAGCTGTGGAACAATAACAGGTAAAGCAATTTATTCTCGCCGGTAACTCGGTGTAGCAAGTTTAAAACATCCCCT

CDS

ATGACAAGCAAAAAATTCTCCTGGCCAAAAACTATCATTGCCCTACTTTTAACCCTAGGTTTATGGCTAGGATTGGCAGACTTACCCACCTATGCCCTGGGGGGTATCCAACCAGAGTTGGATCAACCTGCGCCCCTGTTCACCCTGCCCAGCACCACCGGAGAAGGGGAAGTTAATTTGACAGATTACCGGGGTCAATGGGTGGTTTTATATTTCTATCCCCAGGACTTTACCCCCGGTTGTACCTTGGAGGCCCAGCGTTTCCAGCGGGATTTGACCAAATATCAAGCTCTCAATGCCCAGGTAATTGGGGTAAGTGTGGACGACTTAGACTCCCATGAAGCTTTTTGTGATGCGGAAGGGCTTAAGTTTCCCCTGCTGGCGGACTCCGACGGGGCAGTAATCAAGACCTATGGCTCTTGGCTCAGTGGCATGGCCCTACGACACACCTACGTCATCGATCCCGAGGGTATTTTGCGGGAAAGATTTCTGGGAGTGAGACCCGCCACCCACAGTGAAGAAGTTTTGGCCCGGTTGGCAGAATTACAAGCCTAA

Protein

MTSKKFSWPKTIIALLLTLGLWLGLADLPTYALGGIQPELDQPAPLFTLPSTTGEGEVNLTDYRGQWVVLYFYPQDFTPGCTLEAQRFQRDLTKYQALNAQVIGVSVDDLDSHEAFCDAEGLKFPLLADSDGAVIKTYGSWLSGMALRHTYVIDPEGILRERFLGVRPATHSEEVLARLAELQA