Your browser is old and dusty. Try Google Chrome!

Details for sll0216

ORF sll0216
Accession NP_440052.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -354 -368 -1.18038 0.252
NP_441061.1_2 Reverse -214 -228 -1.27871 0.255
NP_441061.1_2 Reverse -336 -350 -1.8687 0.274
NP_440557.1_1 Reverse -336 -355 -1.96717 0.28
NP_440795.1_7 Forward -343 -336 14.6904 0.0123
NP_440795.1_7 Reverse -336 -343 14.6904 0.0123
NP_441418.1_6 Reverse -335 -354 -8.55534 0.0273
NP_441418.1_6 Forward -228 -209 -19.1751 0.0854
NP_441418.1_6 Forward -237 -218 -20.65 0.121
NP_441418.1_6 Forward -234 -215 -29.5982 0.23
NP_440815.1_5 Forward -344 -325 11.5042 0.203
NP_440815.1_5 Forward -320 -301 6.29264 0.275
NP_441480.1_8 Reverse -70 -89 14.7491 0.264
NP_442291.1_5 Forward -345 -329 13.8249 0.0261
NP_440897.1_6 Reverse -335 -354 11.2084 0.0705
NP_440897.1_6 Forward -344 -325 -1.67294 0.194
NP_441453.1_1 Forward -351 -333 7.98318 0.204
NP_441453.1_4 Reverse -335 -343 16.539 0.00633
NP_441453.1_4 Forward -344 -336 16.539 0.00633
NP_442151.1_6 Reverse -335 -349 11.7993 0.091
NP_442151.1_6 Forward -344 -330 9.83269 0.139
NP_441818.1_1 Forward -343 -332 18.446 0.0046
NP_441818.1_9 Reverse -65 -84 12.3892 0.106
NP_440226.1_1 Forward -344 -325 8.65258 0.0836
NP_441630.1_3 Reverse -327 -346 10.7175 0.0882
NP_440259.1_4 Reverse -16 -30 8.63588 0.294
NP_442655.1_1 Reverse -330 -349 4.03102 0.225
NP_442173.1_1 Forward -343 -335 15.4574 0.00633
NP_442173.1_1 Reverse -336 -344 15.4574 0.00633
NP_442752.1_4 Forward -344 -337 13.8055 0.0199
NP_442752.1_4 Reverse -335 -342 13.8055 0.0199
NP_443027.1_4 Reverse -333 -343 11.0914 0.107
NP_443027.1_4 Forward -346 -336 5.87989 0.294
NP_442975.1_10 Forward -348 -334 19.3701 0.00397
NP_440784.1_7 Forward -343 -336 15.9687 0.0123
NP_440784.1_7 Reverse -336 -343 15.9687 0.0123
NP_440061.1_9 Forward -92 -78 13.1753 0.0839
NP_440061.1_9 Forward -346 -332 11.602 0.107
NP_440061.1_9 Forward -310 -296 6.48882 0.244
NP_440110.1_4 Reverse -306 -325 4.81767 0.177
NP_440110.1_8 Reverse -333 -352 0.392778 0.211
NP_440878.1_9 Forward -354 -335 14.5524 0.0939
NP_442062.1_8 Reverse -335 -345 19.4496 0.000558
NP_442062.1_8 Forward -344 -334 17.3846 0.00193
NP_441859.1_3 Forward -21 -2 5.89851 0.188
NP_440304.1_4 Forward -346 -336 1.84832 0.299
NP_440304.1_4 Reverse -333 -343 1.84832 0.299
NP_442242.1_4 Forward -343 -336 14.3954 0.0124
NP_442242.1_4 Reverse -336 -343 14.3954 0.0124
NP_439918.1_2 Reverse -65 -84 7.47261 0.154
NP_441200.1_1 Reverse -6 -25 14.2574 0.208
NP_441208.1_9 Reverse -308 -322 5.50613 0.267
NP_442196.1_10 Reverse -333 -352 10.9142 0.237
NP_442110.1_7 Forward -344 -330 0.0979218 0.267
NP_441925.1_4 Forward -82 -63 -16.5208 0.284
NP_440856.1_4 Reverse -328 -347 -3.63879 0.234
NP_441083.1_5 Forward -344 -334 20.3345 0.00053
NP_441083.1_5 Reverse -335 -345 11.3864 0.0159
NP_441083.1_5 Forward -159 -149 -0.41329 0.267
NP_439957.1_9 Reverse -255 -274 9.50102 0.249
NP_441434.1_7 Reverse -337 -351 2.16287 0.288
NP_441738.1_2 Forward -342 -335 15.28 0.0102
NP_441738.1_2 Reverse -337 -344 15.28 0.0102
NP_441558.1_5 Reverse -333 -352 13.0775 0.0626
NP_441558.1_5 Forward -127 -108 8.35759 0.153
NP_440209.1_1 Reverse -335 -343 18.1123 0.00295
NP_440209.1_1 Forward -344 -336 18.1123 0.00295
NP_442889.1_1 Reverse -353 -372 -4.03212 0.149
NP_442889.1_8 Forward -347 -333 11.7987 0.0733
NP_442889.1_8 Reverse -332 -346 5.01387 0.243
NP_442398.1_1 Reverse -316 -335 9.24257 0.257
NP_441713.1_1 Forward -96 -77 -10.522 0.203
NP_440178.1_7 Forward -345 -326 3.93269 0.0199
NP_442059.1_7 Forward -224 -205 15.7856 0.203
NP_442445.1_1 Forward -221 -202 10.8159 0.287
NP_441716.1_1 Reverse -225 -239 4.71948 0.252
NP_442111.1_4 Reverse -334 -348 18.6825 0.00603
NP_441163.1_1 Forward -81 -64 8.69123 0.226
NP_440906.1_5 Forward -343 -336 15.8704 0.0124
NP_440906.1_5 Reverse -336 -343 15.8704 0.0124
NP_440747.1_10 Reverse -332 -344 16.8536 0.00143
NP_440747.1_10 Forward -347 -335 5.34885 0.0141
NP_441130.1_10 Forward -346 -332 11.0127 0.107
NP_442973.1_5 Forward -353 -334 11.3075 0.249
NP_441486.1_1 Reverse -332 -346 13.8643 0.00743
NP_441486.1_1 Forward -347 -333 4.91614 0.0399
NP_440403.1_10 Forward -237 -218 9.24257 0.189
NP_440403.1_10 Forward -163 -144 1.17943 0.291
NP_442848.1_4 Forward -170 -156 6.98109 0.282
NP_441012.1_4 Forward -232 -219 9.75405 0.272
NP_441012.1_4 Reverse -221 -234 8.47575 0.272
NP_441012.1_4 Forward -159 -146 6.70579 0.276
NP_443018.1_3 Forward -343 -336 14.8871 0.0123
NP_443018.1_3 Reverse -336 -343 14.8871 0.0123
NP_441634.1_8 Reverse -333 -347 6.58777 0.114
NP_440376.1_1 Forward -344 -335 19.4693 0.000692
NP_440376.1_1 Reverse -335 -344 19.4693 0.000692
NP_440376.1_1 Reverse -81 -90 5.21127 0.144
NP_440376.1_1 Reverse -310 -319 0.884706 0.259
NP_441588.1_4 Reverse -337 -347 14.238 0.0773
NP_441588.1_4 Forward -342 -332 8.73149 0.14
NP_442730.1_3 Forward -349 -330 17.8957 0.185
NP_442687.1_7 Forward -345 -335 15.8113 0.0125
NP_442687.1_7 Reverse -334 -344 8.92815 0.0994
NP_442485.1_3 Forward -239 -220 1.17943 0.232
NP_441029.1_7 Forward -340 -321 11.8975 0.237
NP_440667.1_2 Forward -185 -166 -7.27704 0.273
NP_441950.1_7 Reverse -59 -78 -4.32711 0.211
NP_440360.1_10 Reverse -212 -226 2.16287 0.27
NP_442658.1_1 Forward -346 -336 15.9091 0.00966
NP_442658.1_1 Reverse -333 -343 7.94438 0.199
NP_441855.2_4 Forward -352 -333 20.9955 0.0115
NP_441414.1_9 Forward -344 -325 7.96426 0.0315
NP_441414.1_9 Reverse -335 -354 -9.047 0.252
NP_440607.1_5 Forward -231 -212 1.0811 0.262
NP_441487.1_6 Forward -299 -280 -1.67217 0.285
NP_441487.1_9 Forward -345 -326 4.12936 0.152
NP_441317.1_4 Reverse -40 -54 10.2279 0.29
NP_441958.1_5 Forward -345 -335 12.2714 0.00183
NP_441958.1_5 Reverse -334 -344 12.2714 0.00183
NP_440984.1_7 Reverse -330 -344 15.3392 0.0563
NP_440984.1_7 Forward -349 -335 11.6026 0.122
NP_442911.1_2 Forward -354 -335 -10.0303 0.268
NP_440153.1_5 Forward -343 -329 2.35953 0.225
NP_442536.1_5 Forward -97 -78 19.3707 0.271
NP_443055.1_6 Forward -73 -55 3.16499 0.2
NP_441099.1_5 Reverse -325 -344 -3.14714 0.131
NP_441099.1_5 Forward -354 -335 -11.3086 0.276
NP_442002.1_1 Forward -232 -214 -10.3056 0.292
NP_442002.1_9 Forward -345 -338 10.7572 0.185
NP_442598.1_2 Forward -171 -162 14.5527 0.252
NP_441294.1_7 Forward -348 -334 10.8824 0.167
NP_441646.1_1 Forward -351 -332 4.12936 0.199
NP_442438.1_10 Forward -349 -335 2.16287 0.185
NP_442438.1_10 Reverse -330 -344 -0.0987402 0.248
NP_442431.1_10 Reverse -65 -83 11.1305 0.103
NP_441000.1_6 Forward -345 -331 13.3726 0.0396
NP_440484.1_3 Reverse -333 -347 11.8976 0.242
NP_440147.1_4 Forward -346 -333 20.2755 0.00228
NP_440147.1_4 Reverse -333 -346 7.49244 0.0678
NP_441550.1_8 Reverse -333 -343 15.1225 0.0132
NP_441550.1_8 Forward -346 -336 8.3377 0.124
NP_441916.1_7 Reverse -335 -345 18.4663 0.00144
NP_441916.1_7 Forward -344 -334 10.3048 0.0261
NP_441041.1_4 Reverse -348 -367 -0.885524 0.0986
NP_441041.1_4 Forward -344 -325 -3.83545 0.126
NP_441041.1_4 Reverse -228 -247 -10.0303 0.227
NP_441041.1_4 Forward -228 -209 -12.5869 0.269
NP_441041.1_7 Reverse -332 -344 10.8188 0.0864
NP_441041.1_7 Forward -347 -335 9.55551 0.109
NP_441041.1_7 Forward -50 -38 5.95994 0.231
NP_442396.1_5 Forward -348 -335 9.85238 0.128
NP_441725.1_5 Forward -343 -333 2.04498 0.115
NP_441725.1_5 Reverse -336 -346 2.04498 0.115
NP_439966.1_7 Reverse -333 -343 15.3192 0.0152
NP_439966.1_7 Forward -346 -336 9.91099 0.0968
NP_439966.1_9 Forward -346 -337 0.884706 0.253
NP_442941.1_3 Forward -343 -333 19.2529 0.00262
NP_442941.1_3 Reverse -336 -346 2.63497 0.14
NP_440289.1_2 Reverse -332 -345 5.91914 0.0605
NP_440289.1_2 Forward -347 -334 3.06754 0.0811
NP_440983.1_5 Reverse -207 -226 1.86774 0.204
NP_440983.1_5 Reverse -213 -232 -6.49039 0.277
NP_440983.1_5 Reverse -176 -195 -7.57203 0.291
NP_440260.1_8 Reverse -61 -79 6.01734 0.154
NP_440260.1_8 Forward -353 -335 -7.55234 0.295
NP_441514.1_1 Forward -293 -283 14.0586 0.284
NP_441514.1_6 Reverse -347 -354 14.2971 0.248
NP_442281.1_1 Reverse -330 -344 16.8135 0.00698
NP_442281.1_1 Forward -349 -335 11.7003 0.0438
NP_442281.1_1 Forward -324 -310 6.48882 0.124
NP_442256.1_2 Reverse -333 -351 -5.58572 0.214
NP_440437.1_1 Forward -350 -331 -1.86883 0.207
NP_441556.1_10 Reverse -75 -89 12.0712 0.2
NP_442982.1_5 Reverse -338 -357 5.89931 0.156
NP_440375.1_8 Forward -343 -324 12.9791 0.129
NP_441644.1_6 Forward -344 -334 17.3841 0.00127
NP_441644.1_6 Reverse -335 -345 10.1076 0.0628
NP_442215.1_2 Forward -346 -330 8.12167 0.0666
NP_442215.1_2 Reverse -333 -349 0.943514 0.144
NP_442215.1_2 Reverse -315 -331 -5.05468 0.244
NP_442029.1_6 Reverse -65 -84 7.66927 0.223
NP_442029.1_6 Reverse -330 -349 4.22769 0.271
NP_442247.1_8 Reverse -333 -347 9.63603 0.247
NP_440253.1_2 Reverse -335 -353 -2.14413 0.261
NP_440253.1_2 Forward -344 -326 -2.73412 0.274
NP_440929.1_8 Forward -344 -335 19.2726 0.000701
NP_440929.1_8 Reverse -335 -344 19.2726 0.000701
NP_440929.1_9 Forward -189 -175 13.4709 0.279
NP_442933.1_1 Forward -278 -259 7.4002 0.253
NP_442933.1_10 Forward -344 -335 17.601 0.00325
NP_442933.1_10 Reverse -335 -344 17.601 0.00325
NP_441751.2_8 Forward -343 -329 -4.52363 0.174
NP_442926.1_3 Reverse -343 -362 13.8641 0.102
NP_442926.1_5 Forward -349 -330 11.1439 0.221
NP_442554.1_8 Forward -343 -333 16.2046 0.0065
NP_442554.1_8 Reverse -336 -346 13.2547 0.0187
NP_442863.1_5 Forward -355 -336 14.9458 0.281
NP_442970.1_1 Forward -334 -320 13.476 0.269
NP_441762.1_7 Reverse -334 -346 10.1671 0.0142
NP_441762.1_7 Forward -345 -333 2.39892 0.0676
NP_442313.1_4 Reverse -65 -84 7.7676 0.286
NP_442142.1_4 Reverse -332 -345 14.7683 0.0302
NP_442142.1_4 Forward -347 -334 4.64028 0.214
NP_442142.1_4 Forward -237 -224 4.54195 0.217
NP_442142.1_4 Forward -316 -303 2.87033 0.273
NP_442292.1_1 Forward -343 -334 18.486 0.00229
NP_442292.1_1 Reverse -336 -345 9.63616 0.0183
NP_442292.1_5 Forward -361 -342 -1.47551 0.265
NP_442476.1_6 Forward -89 -75 7.07942 0.116
NP_442476.1_6 Forward -343 -329 4.32615 0.144
NP_442381.1_1 Reverse -72 -91 16.7738 0.287
NP_443009.1_5 Reverse -334 -345 18.3477 0.00265
NP_443009.1_5 Forward -90 -79 6.84301 0.147
NP_443009.1_5 Forward -91 -80 4.38475 0.249
NP_443009.1_5 Reverse -80 -91 3.99143 0.268
NP_442301.1_2 Forward -81 -62 3.24359 0.299
NP_442408.2_1 Forward -357 -338 -6.58872 0.282
NP_442741.1_5 Reverse -108 -127 10.8159 0.246
NP_441715.1_4 Forward -343 -333 17.3846 0.0106
NP_441715.1_4 Reverse -336 -346 9.41981 0.097
NP_440183.1_9 Reverse -221 -240 -17.5035 0.276
NP_441468.1_1 Forward -343 -336 15.8704 0.0124
NP_441468.1_1 Reverse -336 -343 15.8704 0.0124
NP_442099.1_1 Reverse -336 -354 13.6872 0.274
NP_441020.2_6 Reverse -333 -350 8.20031 0.205
NP_441015.1_10 Forward -239 -220 7.57094 0.0996
NP_441015.1_10 Reverse -330 -349 -4.42544 0.203
NP_441015.1_10 Forward -362 -343 -7.27704 0.265
NP_441673.1_1 Forward -344 -335 20.8459 0.000698
NP_441673.1_1 Reverse -335 -344 20.8459 0.000698
NP_440265.1_8 Forward -323 -305 15.7521 0.217
NP_441826.1_2 Reverse -329 -343 -2.26202 0.269
NP_441826.1_2 Forward -350 -336 -3.44199 0.285
NP_441330.1_1 Reverse -330 -349 8.06259 0.0252
NP_442490.1_9 Forward -356 -337 -3.14714 0.227
NP_442868.1_6 Reverse -333 -343 19.2529 0.00563
NP_442868.1_6 Forward -346 -336 0.865012 0.205
NP_441251.1_2 Forward -273 -255 13.0972 0.262
NP_441612.1_2 Forward -344 -334 8.54929 0.21
NP_442361.1_3 Forward -350 -337 9.2624 0.276
NP_442427.1_3 Forward -362 -344 1.78911 0.196
NP_442808.1_1 Forward -345 -335 18.4657 0.00201
NP_442808.1_1 Reverse -334 -344 8.63269 0.0481
NP_442808.1_1 Forward -75 -65 2.43787 0.266
NP_442808.1_1 Forward -91 -81 2.33954 0.27
NP_441290.1_6 Forward -130 -111 14.9458 0.289
NP_440145.1_3 Reverse -325 -344 5.80098 0.0599
NP_442542.1_2 Forward -346 -333 9.36073 0.135
NP_442542.1_9 Forward -351 -337 5.99717 0.255
NP_442113.1_10 Reverse -169 -188 -9.34199 0.295
NP_442050.1_5 Reverse -333 -343 14.3359 0.0206
NP_441878.1_6 Forward -345 -335 10.4031 0.0176
NP_441878.1_6 Reverse -334 -344 10.4031 0.0176
NP_441878.1_6 Reverse -224 -234 -0.118297 0.167
NP_441878.1_6 Forward -327 -317 -7.39479 0.222
NP_441036.1_8 Forward -345 -335 17.7779 0.000554
NP_441036.1_8 Reverse -334 -344 8.33817 0.174
NP_441557.1_5 Forward -344 -335 19.9609 0.000699
NP_441557.1_5 Reverse -335 -344 19.9609 0.000699
NP_441445.1_1 Reverse -9 -28 -0.295539 0.289
NP_441590.1_4 Forward -90 -71 2.55527 0.293
NP_442066.2_4 Forward -383 -364 -7.57203 0.28
NP_442066.2_9 Reverse -331 -344 8.47575 0.185
NP_440101.1_5 Reverse -218 -237 3.04771 0.206
NP_441458.1_10 Forward -353 -334 12.8808 0.0863
NP_441407.1_5 Reverse -325 -344 5.60432 0.204
NP_442397.1_9 Forward -326 -307 1.76941 0.283
NP_441116.1_6 Reverse -348 -367 13.6675 0.162
NP_441116.1_9 Reverse -38 -52 12.586 0.25
NP_441459.1_3 Reverse -216 -235 10.5529 0.296
NP_441574.1_1 Forward -356 -337 -6.29373 0.276
NP_441549.1_1 Forward -379 -360 14.0599 0.281
NP_441549.1_9 Forward -238 -220 -9.22396 0.244
NP_442170.1_5 Forward -344 -325 -0.197208 0.233
NP_442347.1_2 Forward -343 -334 12.4878 0.056
NP_442347.1_2 Reverse -336 -345 11.1111 0.056
NP_442645.1_2 Reverse -327 -346 -2.75381 0.0487
NP_442645.1_2 Forward -359 -340 -18.1918 0.27
NP_440547.1_1 Reverse -214 -233 9.14342 0.252
NP_441037.1_4 Forward -346 -336 14.7245 0.028
NP_442594.1_8 Reverse -62 -81 9.43923 0.192
NP_441633.1_3 Reverse -333 -346 10.8357 0.0286
NP_441633.1_3 Forward -346 -333 3.46087 0.0699
NP_440136.1_2 Forward -343 -336 15.9687 0.0123
NP_440136.1_2 Reverse -336 -343 15.9687 0.0123
NP_442590.1_10 Forward -240 -221 3.04771 0.297
NP_442998.1_10 Forward -342 -335 15.5754 0.0102
NP_442998.1_10 Reverse -337 -344 15.5754 0.0102
NP_440299.1_1 Forward -348 -335 20.5698 0.00128
NP_440299.1_1 Reverse -331 -344 2.37867 0.291
NP_441799.1_1 Reverse -331 -345 13.8636 0.0293
NP_441799.1_1 Forward -348 -334 5.70218 0.197
NP_441007.1_10 Reverse -330 -343 0.707601 0.219
NP_442201.1_10 Forward -355 -336 -5.9004 0.181
NP_442299.1_1 Reverse -77 -96 19.174 0.263
NP_440256.1_1 Reverse -332 -351 19.5673 0.00424
NP_441559.1_8 Reverse -75 -89 4.91614 0.104
NP_441559.1_8 Reverse -76 -90 3.44117 0.143
NP_441559.1_8 Reverse -355 -369 -4.81863 0.238
NP_441559.1_8 Reverse -305 -319 -5.90027 0.271
NP_441559.1_8 Forward -363 -349 -5.9986 0.271
NP_441559.1_8 Forward -349 -335 -6.49025 0.279
NP_441559.1_8 Forward -95 -81 -6.68692 0.279
NP_440915.1_6 Forward -348 -334 5.30946 0.091
NP_440915.1_6 Reverse -331 -345 1.76955 0.131
NP_440717.1_1 Forward -73 -54 9.73422 0.24
NP_441704.1_7 Reverse -341 -360 18.0924 0.222
NP_441704.1_8 Forward -355 -336 8.16011 0.211
NP_441464.1_8 Forward -182 -168 7.17775 0.217
NP_441464.1_8 Forward -20 -6 7.17775 0.217
NP_441464.1_10 Reverse -61 -75 15.7325 0.166
NP_441939.1_3 Reverse -336 -355 10.2259 0.128
NP_442957.1_8 Reverse -62 -81 9.24257 0.287
NP_442993.1_1 Reverse -74 -90 -11.5445 0.251
NP_440677.1_1 Forward -353 -334 6.88262 0.247
NP_442386.1_9 Forward -345 -336 15.7322 0.0144
NP_442386.1_9 Reverse -334 -343 13.8639 0.0289
NP_440570.1_5 Forward -232 -213 14.7491 0.111
NP_441750.1_1 Forward -228 -209 -5.21209 0.21
NP_441340.1_5 Forward -343 -336 15.6737 0.0124
NP_441340.1_5 Reverse -336 -343 15.6737 0.0124
NP_442484.1_2 Forward -355 -336 1.96607 0.226
NP_440168.1_9 Reverse -333 -352 -5.99873 0.296
NP_440327.1_6 Reverse -65 -84 12.0942 0.176
NP_440327.1_6 Reverse -59 -78 3.6377 0.282
NP_440586.1_1 Reverse -61 -80 -0.787193 0.237
NP_440586.1_8 Forward -343 -336 13.2151 0.026
NP_440586.1_8 Reverse -336 -343 13.2151 0.026
NP_442251.1_6 Forward -343 -336 15.2804 0.0124
NP_442251.1_6 Reverse -336 -343 15.2804 0.0124
NP_441262.1_3 Reverse -335 -342 14.7888 0.0223
NP_441262.1_3 Forward -344 -337 14.7888 0.0223
NP_440027.1_3 Forward -90 -72 8.96649 0.187
NP_440027.1_3 Forward -89 -71 3.8533 0.263
NP_440027.1_3 Reverse -166 -184 1.98502 0.295
NP_443051.1_1 Reverse -334 -343 10.4228 0.00754
NP_443051.1_1 Forward -345 -336 10.4228 0.00754
NP_439937.1_8 Forward -79 -60 0.58944 0.235
NP_439937.1_9 Forward -90 -73 -9.59824 0.196
NP_439937.1_9 Forward -60 -43 -11.1715 0.245
NP_443039.1_7 Reverse -214 -228 6.88214 0.19
NP_440408.1_3 Reverse -222 -241 -4.32711 0.268
NP_440626.1_1 Reverse -336 -355 10.1267 0.247
NP_440439.1_1 Reverse -332 -345 1.9859 0.138
NP_442239.1_8 Reverse -58 -77 7.17762 0.258
NP_442239.1_8 Forward -234 -215 5.80098 0.266
NP_440372.1_2 Forward -343 -336 16.3621 0.0124
NP_440372.1_2 Reverse -336 -343 16.3621 0.0124
NP_441181.1_6 Reverse -336 -354 9.16393 0.219
NP_441789.1_7 Forward -82 -63 6.58682 0.193
NP_441789.1_7 Forward -81 -62 -0.591301 0.251
NP_440316.1_10 Forward -229 -219 7.45319 0.251
NP_439977.1_5 Forward -363 -344 7.57094 0.117
NP_440139.1_1 Reverse -329 -348 6.58682 0.14
NP_440267.1_2 Reverse -330 -344 11.307 0.125
NP_442384.1_10 Reverse -335 -348 16.0472 0.00946
NP_442384.1_10 Forward -90 -77 7.6891 0.0764
NP_442384.1_10 Forward -344 -331 4.54251 0.153
NP_442114.1_8 Forward -57 -43 9.04542 0.234
NP_441877.1_7 Forward -85 -66 6.48849 0.218
NP_441877.1_7 Reverse -199 -218 2.45694 0.228
NP_442790.1_4 Forward -353 -334 -14.2585 0.274
NP_442262.1_10 Forward -343 -336 14.1988 0.0123
NP_442262.1_10 Reverse -336 -343 14.1988 0.0123
NP_441689.1_5 Reverse -333 -343 5.78111 0.197
NP_440163.1_10 Reverse -222 -232 9.81313 0.222
NP_440163.1_10 Forward -231 -221 8.92815 0.256
NP_440344.1_10 Forward -351 -334 8.29864 0.0111
NP_440282.1_10 Reverse -215 -234 -7.86702 0.254
NP_440531.1_6 Reverse -327 -346 9.83255 0.0728
NP_441335.1_8 Reverse -47 -66 7.86593 0.264
NP_441965.1_10 Reverse -78 -94 7.2367 0.151
NP_440297.1_9 Forward -343 -333 -0.118297 0.282
NP_440297.1_9 Reverse -336 -346 -0.118297 0.282
NP_440297.1_9 Reverse -220 -230 -0.216628 0.282
NP_442280.1_5 Reverse -1 -20 15.979 0.226
NP_440990.1_7 Forward -356 -337 13.2741 0.16
NP_440894.1_7 Reverse -302 -321 10.4217 0.241
NP_440894.1_10 Reverse -223 -242 2.85105 0.281
NP_440999.1_9 Forward -348 -334 5.21113 0.113
NP_440888.1_2 Forward -344 -330 17.4035 0.00402
NP_440888.1_2 Reverse -335 -349 12.487 0.0442
NP_440888.1_2 Forward -357 -343 11.307 0.0705
NP_440600.1_4 Forward -352 -334 -0.0791831 0.146
NP_440060.1_2 Reverse -292 -311 15.1416 0.238
NP_440491.1_1 Reverse -332 -351 14.0314 0.114
NP_440052.1_1 Forward -58 -39 30.0887 0.0005
NP_440052.1_2 Forward -37 -18 29.3021 0.000115
NP_440052.1_3 Forward -265 -246 27.7288 0.00159
NP_440052.1_4 Forward -100 -81 32.1537 0.0000154
NP_440052.1_5 Forward -355 -336 28.5154 0.00106
NP_440052.1_6 Forward -190 -171 25.6629 0.00171
NP_440052.1_7 Forward -328 -309 29.5971 0.000333
NP_440052.1_8 Forward -227 -208 18.6823 0.0498
NP_440052.1_10 Forward -387 -368 21.1397 0.0337
NP_439969.1_3 Forward -349 -330 13.5691 0.0852
NP_442277.1_4 Forward -353 -334 0.785326 0.299
NP_440575.1_1 Forward -140 -121 -0.984623 0.29
NP_440105.1_3 Forward -163 -149 16.5185 0.285
NP_441543.1_2 Reverse -336 -345 18.486 0.00236
NP_441543.1_2 Forward -343 -334 16.9127 0.00359
NP_442845.1_2 Reverse -329 -343 3.63784 0.282
NP_441834.1_10 Forward -362 -343 1.47442 0.267
NP_441178.1_6 Reverse -209 -228 6.68515 0.268
NP_441319.1_5 Forward -168 -149 10.4225 0.253
NP_441319.1_8 Reverse -204 -222 7.88563 0.239
NP_441469.1_8 Forward -345 -336 16.126 0.00797
NP_441469.1_8 Reverse -334 -343 6.48957 0.227
NP_442315.1_2 Reverse -2 -14 8.39711 0.294
NP_443064.1_6 Forward -344 -334 12.5669 0.0796
NP_443064.1_6 Forward -90 -80 10.8217 0.13
NP_443064.1_6 Reverse -81 -91 9.27034 0.234
NP_442646.1_6 Forward -252 -233 17.3057 0.0456
NP_442578.1_7 Forward -343 -336 14.5921 0.026
NP_442578.1_7 Reverse -336 -343 14.5921 0.026
NP_440710.1_1 Reverse -168 -186 7.59063 0.113
NP_440710.1_1 Forward -152 -134 -0.0791831 0.163
NP_440710.1_1 Forward -352 -334 -9.0273 0.292
NP_441462.1_2 Forward -344 -334 11.5831 0.00406
NP_441462.1_2 Reverse -335 -345 11.5831 0.00406
NP_441462.1_5 Reverse -297 -316 1.37609 0.291
NP_443062.1_1 Forward -344 -326 16.834 0.0287
NP_442204.1_1 Forward -337 -326 8.4168 0.0945
NP_441560.1_3 Forward -73 -55 6.31233 0.28
NP_441351.1_8 Forward -82 -63 4.71934 0.225
NP_440516.1_8 Forward -344 -335 16.9127 0.00442
NP_440516.1_8 Reverse -335 -344 16.9127 0.00442
NP_442428.1_5 Forward -343 -336 15.8704 0.0124
NP_442428.1_5 Reverse -336 -343 15.8704 0.0124
NP_441443.1_7 Reverse -356 -375 -2.45882 0.27
NP_442823.1_8 Forward -320 -301 11.9958 0.275
NP_440673.1_2 Forward -354 -335 15.3647 0.0888
NP_440673.1_3 Forward -342 -335 12.4288 0.0426
NP_440673.1_3 Reverse -337 -344 12.4288 0.0426
NP_440673.1_3 Reverse -13 -20 7.51227 0.252
NP_441052.1_2 Forward -344 -334 19.9412 0.00106
NP_441052.1_2 Reverse -335 -345 10.5014 0.0285
NP_442219.1_9 Forward -343 -334 17.7976 0.00718
NP_442219.1_9 Reverse -336 -345 8.35786 0.0681
NP_440592.1_5 Forward -315 -296 16.9115 0.222
NP_440436.1_4 Reverse -336 -345 18.1905 0.00233
NP_440436.1_4 Forward -343 -334 17.2072 0.00233
NP_441884.1_9 Reverse -332 -351 -12.7836 0.138
NP_441884.1_9 Reverse -222 -241 -14.7502 0.138
NP_441884.1_9 Reverse -170 -189 -23.01 0.284
NP_442864.1_3 Forward -350 -331 9.0459 0.212
NP_442907.1_9 Forward -318 -299 -6.1954 0.289
NP_441719.1_4 Forward -343 -336 16.3621 0.0124
NP_441719.1_4 Reverse -336 -343 16.3621 0.0124
NP_441733.1_10 Reverse -332 -345 9.85238 0.106
NP_441004.1_1 Reverse -65 -84 13.3725 0.0361
NP_441004.1_1 Forward -228 -209 -12.9802 0.251
NP_441004.1_1 Reverse -59 -78 -16.5201 0.286
NP_441004.1_2 Forward -379 -360 1.47442 0.22
NP_441004.1_5 Forward -372 -358 7.76774 0.284
NP_442366.1_3 Reverse -334 -352 -0.570838 0.194
NP_442366.1_5 Forward -347 -337 13.3526 0.0775
NP_442873.1_2 Forward -361 -342 10.3234 0.266
NP_442694.1_4 Reverse -64 -73 12.2911 0.253
NP_442206.1_7 Forward -359 -340 8.65258 0.295
NP_443054.1_2 Reverse -333 -347 9.04604 0.102
NP_443054.1_2 Forward -91 -77 1.27789 0.25
NP_441851.1_9 Forward -231 -212 7.57094 0.279
NP_441851.1_10 Forward -345 -335 16.008 0.00552
NP_441851.1_10 Reverse -334 -344 15.8113 0.00552
NP_441851.1_10 Reverse -80 -90 4.79825 0.247
NP_442622.1_8 Forward -344 -326 -18.7621 0.268
NP_441501.1_9 Reverse -217 -236 14.7483 0.253
NP_442856.1_7 Forward -353 -334 -3.44213 0.243
NP_442515.1_1 Forward -345 -331 0.982901 0.174
NP_442515.1_1 Forward -21 -7 -0.295402 0.217
NP_442515.1_1 Reverse -334 -348 -2.26202 0.271
NP_441396.1_5 Forward -187 -178 8.25953 0.224
NP_441396.1_5 Reverse -75 -84 7.57121 0.241
NP_440593.1_3 Reverse -330 -349 -1.96717 0.219
NP_441349.1_10 Reverse -325 -344 9.14423 0.0248
NP_441349.1_10 Reverse -71 -90 -9.63698 0.297
NP_440432.1_9 Forward -343 -328 12.6646 0.0232
NP_440432.1_9 Reverse -336 -351 -0.413427 0.164
NP_439960.1_10 Forward -192 -174 3.95239 0.163
NP_442944.1_9 Reverse -326 -345 15.0441 0.279
NP_442450.1_5 Forward -346 -336 7.55152 0.13
NP_442168.1_5 Forward -90 -71 -0.787193 0.264
NP_442006.1_2 Reverse -341 -358 -8.90928 0.197
NP_442006.1_2 Forward -228 -211 -14.0225 0.2
NP_442006.1_2 Reverse -225 -242 -14.7108 0.208
NP_442006.1_2 Reverse -335 -352 -18.0541 0.287
NP_442006.1_2 Reverse -182 -199 -18.8407 0.296
NP_441003.1_9 Forward -353 -334 5.01433 0.271
NP_441003.1_9 Reverse -216 -235 4.71934 0.277
NP_442243.1_1 Reverse -329 -347 -2.63651 0.295
NP_441570.1_1 Forward -344 -326 0.314141 0.0395
NP_441570.1_1 Reverse -335 -353 -16.7954 0.254
NP_441078.1_4 Forward -344 -335 19.6659 0.0007
NP_441078.1_4 Reverse -335 -344 19.6659 0.0007
NP_441078.1_4 Forward -90 -81 -2.06522 0.295
NP_442729.1_8 Forward -93 -80 9.55739 0.125
NP_442729.1_8 Forward -348 -335 9.06573 0.125
NP_441539.1_5 Reverse -122 -141 17.5024 0.27
NP_442443.1_1 Reverse -99 -118 -2.45882 0.256
NP_440526.1_3 Forward -343 -332 10.2846 0.0646
NP_441432.1_8 Reverse -334 -343 16.8143 0.00595
NP_441432.1_8 Forward -345 -336 8.25953 0.0755
NP_441432.1_8 Forward -21 -12 5.21127 0.185
NP_442320.1_8 Reverse -329 -343 13.4709 0.0144
NP_442320.1_8 Forward -350 -336 5.50613 0.0351
NP_441732.1_2 Forward -348 -332 -6.92296 0.0558
NP_441732.1_2 Reverse -344 -360 -15.4778 0.147
NP_441732.1_2 Reverse -221 -237 -16.4611 0.167
NP_441030.1_6 Forward -346 -327 16.7022 0.155
NP_442003.1_4 Forward -343 -324 11.4058 0.277
NP_440760.1_1 Reverse -335 -354 -14.7502 0.135
NP_440760.1_1 Forward -344 -325 -21.0434 0.228
NP_442797.1_1 Forward -123 -104 1.57275 0.212
NP_440199.1_10 Reverse -332 -342 7.25653 0.231
NP_440199.1_10 Reverse -132 -142 6.76487 0.269
NP_441057.1_3 Reverse -73 -92 -11.8986 0.247
NP_442353.1_4 Forward -350 -331 4.91521 0.194
NP_442407.1_8 Reverse -335 -354 17.5024 0.169
NP_441072.1_2 Reverse -324 -343 11.8975 0.181
NP_442489.1_7 Forward -344 -335 20.1576 0.000695
NP_442489.1_7 Reverse -335 -344 20.1576 0.000695
NP_440559.1_1 Forward -343 -334 17.4043 0.00658
NP_440559.1_1 Reverse -336 -345 8.75118 0.0586
NP_441659.2_8 Forward -344 -334 18.1713 0.00133
NP_441659.2_8 Reverse -335 -345 11.9764 0.0147
NP_442913.1_9 Forward -350 -331 15.7324 0.13
NP_442913.1_10 Reverse -326 -345 0.294447 0.155
NP_440779.1_5 Reverse -335 -352 -14.9075 0.287
NP_442346.1_1 Reverse -65 -84 11.4058 0.27
NP_442346.1_5 Reverse -334 -344 16.6963 0.00248
NP_442346.1_5 Forward -345 -335 9.02648 0.118
NP_440545.1_3 Reverse -350 -367 -2.02611 0.179
NP_440545.1_3 Forward -78 -61 -6.746 0.287
NP_441856.1_7 Reverse -65 -84 8.45592 0.292
NP_440025.1_3 Reverse -314 -328 14.096 0.235
NP_441629.1_1 Forward -334 -315 6.88262 0.253
NP_440743.1_3 Forward -125 -108 21.475 0.0375
NP_441923.1_6 Forward -227 -213 18.9775 0.109
NP_440486.1_6 Forward -229 -210 5.70265 0.293
NP_440459.1_2 Reverse -326 -343 11.0519 0.183
NP_440459.1_2 Forward -353 -336 9.97027 0.212
NP_440459.1_2 Reverse -333 -350 8.88863 0.246
NP_440010.1_3 Reverse -53 -72 1.27776 0.25
NP_440010.1_4 Forward -84 -65 -1.37794 0.267
NP_441943.1_8 Forward -70 -51 -5.9004 0.261
NP_441585.1_5 Forward -123 -104 -0.689632 0.296
NP_441585.1_5 Forward -122 -103 -0.787962 0.298
NP_441888.1_7 Forward -349 -335 3.04785 0.225
NP_441888.1_7 Forward -314 -300 1.08123 0.267
NP_441050.1_5 Reverse -61 -79 -0.275845 0.256
NP_441948.1_4 Forward -351 -333 5.42735 0.0773
NP_441502.1_3 Reverse -333 -352 5.30933 0.291
NP_441833.1_4 Forward -343 -336 15.9687 0.0124
NP_441833.1_4 Reverse -336 -343 15.9687 0.0124
NP_442799.1_8 Forward -27 -8 7.79413 0.283
NP_442162.1_8 Reverse -222 -241 -3.93378 0.291
NP_442162.1_9 Forward -343 -336 16.2637 0.0124
NP_442162.1_9 Reverse -336 -343 16.2637 0.0124
NP_440671.1_4 Forward -234 -220 7.57108 0.214
NP_440224.1_1 Reverse -324 -343 3.34271 0.132
NP_440204.1_4 Reverse -59 -78 2.16274 0.238
NP_442140.1_3 Reverse -336 -346 16.2046 0.0255
NP_442140.1_3 Forward -343 -333 10.3048 0.0902
NP_440875.1_9 Forward -342 -332 7.69067 0.255
NP_441813.1_5 Reverse -333 -343 18.1713 0.00743
NP_441813.1_5 Forward -346 -336 9.91146 0.021
NP_442089.1_1 Reverse -332 -351 -1.96717 0.288
NP_440590.1_4 Reverse -336 -349 18.3088 0.00811
NP_440590.1_4 Forward -343 -330 11.229 0.0216
NP_440567.1_1 Reverse -336 -350 13.0776 0.0213
NP_440567.1_1 Forward -343 -329 1.67122 0.196
NP_440567.1_4 Reverse -62 -81 7.07928 0.19
NP_442497.1_10 Forward -343 -334 10.4228 0.0087
NP_442497.1_10 Reverse -336 -345 10.4228 0.0087
NP_440821.1_4 Forward -346 -336 10.2065 0.0163
NP_440821.1_4 Reverse -333 -343 9.41981 0.0286
NP_441239.1_9 Forward -346 -334 12.3303 0.0477
NP_441239.1_9 Reverse -333 -345 7.80712 0.148
NP_441239.1_9 Reverse -217 -229 6.1355 0.2
NP_441951.1_4 Reverse -335 -354 1.57275 0.283
NP_440400.1_1 Forward -318 -299 2.35861 0.263
NP_440400.1_1 Forward -83 -64 -1.47628 0.285
NP_440665.1_1 Reverse -213 -232 -4.42544 0.186
NP_440796.1_3 Forward -351 -333 6.80322 0.298
NP_442270.1_9 Forward -355 -336 -7.96535 0.215
NP_440900.1_5 Reverse -6 -25 16.8898 0.201
NP_442809.1_6 Reverse -348 -367 5.89931 0.256
NP_440546.1_4 Reverse -335 -345 11.8882 0.0679
NP_440546.1_4 Forward -344 -334 10.046 0.109
NP_442041.1_3 Reverse -209 -227 15.5554 0.158
NP_441509.1_4 Reverse -130 -149 6.58763 0.243
NP_440675.1_3 Reverse -143 -162 4.62101 0.3
NP_440462.1_6 Reverse -333 -343 9.61647 0.0429
NP_440462.1_6 Forward -346 -336 9.02648 0.0498
NP_442340.1_3 Reverse -227 -246 -9.73531 0.275
NP_440868.1_4 Reverse -331 -343 7.80712 0.0637
NP_440868.1_4 Forward -348 -336 1.61227 0.177
NP_440374.1_3 Reverse -266 -284 12.4159 0.272
NP_441582.1_5 Reverse -315 -334 3.04693 0.279
NP_441474.1_1 Reverse -215 -234 5.70185 0.212
NP_440638.2_2 Reverse -211 -230 15.6341 0.189
NP_440812.1_10 Reverse -100 -113 12.6056 0.259
NP_442039.1_4 Forward -343 -336 15.1821 0.0124
NP_442039.1_4 Reverse -336 -343 15.1821 0.0124
NP_442273.1_6 Reverse -158 -176 16.7305 0.249
NP_442380.1_10 Forward -367 -349 8.96727 0.262
NP_441926.1_3 Forward -344 -328 5.56507 0.17
NP_440825.1_7 Reverse -336 -346 12.4217 0.155
NP_442837.1_3 Forward -343 -336 15.7721 0.0124
NP_442837.1_3 Reverse -336 -343 15.7721 0.0124
NP_440160.1_2 Reverse -170 -189 3.6377 0.217
NP_440160.1_3 Reverse -213 -232 10.0284 0.23
NP_440160.1_7 Reverse -356 -375 10.6192 0.297
NP_442053.1_1 Forward -344 -335 18.3876 0.0007
NP_442053.1_1 Reverse -335 -344 18.3876 0.0007
NP_440505.1_3 Reverse -333 -343 18.3679 0.00213
NP_440505.1_3 Forward -346 -336 6.76487 0.169
NP_440505.1_7 Forward -351 -332 0.687771 0.257
NP_440351.1_8 Reverse -136 -154 5.42735 0.271
NP_441252.1_6 Reverse -157 -164 11.6422 0.288
NP_440308.1_6 Forward -321 -302 2.75272 0.296
NP_441408.2_7 Reverse -333 -352 -3.44213 0.272
NP_441408.2_7 Forward -335 -316 -5.70374 0.299
NP_440914.1_1 Forward -344 -334 17.5935 0.000537
NP_440914.1_1 Reverse -335 -345 8.6151 0.186
NP_440914.1_1 Forward -319 -309 8.12715 0.207
NP_440914.1_1 Reverse -348 -358 6.66328 0.269
NP_441011.1_8 Reverse -336 -345 16.9127 0.00602
NP_441011.1_8 Forward -343 -334 8.25953 0.144
NP_442931.1_8 Forward -116 -97 4.916 0.232
NP_442533.1_1 Forward -231 -212 -13.1769 0.237
NP_442533.1_1 Forward -240 -221 -16.3235 0.265
NP_442533.1_6 Forward -344 -335 17.2076 0.00137
NP_442533.1_6 Reverse -335 -344 17.2076 0.00137
NP_442533.1_6 Forward -234 -225 4.32629 0.184
NP_442533.1_6 Reverse -176 -185 2.94966 0.232
NP_442541.1_10 Reverse -225 -239 0.687325 0.3
NP_442322.1_4 Reverse -212 -229 -8.71327 0.286
NP_441482.1_7 Forward -350 -336 -10.4235 0.209
NP_439944.1_9 Forward -343 -333 10.5014 0.0887
NP_441028.1_6 Reverse -29 -39 3.51951 0.292
NP_441527.1_4 Forward -26 -7 -12.2711 0.285
NP_440115.1_6 Reverse -332 -342 6.8632 0.167
NP_441170.1_4 Forward -189 -171 4.9357 0.228
NP_441972.1_5 Reverse -336 -355 -3.14714 0.197
NP_441106.1_1 Forward -345 -336 18.191 0.0028
NP_441106.1_1 Reverse -334 -343 9.63616 0.0311
NP_442455.1_7 Reverse -322 -341 20.6016 0.14
NP_442588.1_6 Reverse -31 -50 2.55606 0.23
NP_440797.1_8 Reverse -308 -327 17.8792 0.268
NP_441186.1_9 Forward -82 -63 16.8141 0.182
NP_441286.1_1 Reverse -334 -346 6.03717 0.0258
NP_441286.1_1 Forward -345 -333 3.38223 0.0467
NP_440670.1_8 Forward -344 -335 18.3876 0.000699
NP_440670.1_8 Reverse -335 -344 18.3876 0.000699
NP_441930.1_2 Reverse -359 -369 12.5664 0.258
NP_440886.1_7 Forward -345 -335 17.7774 0.0011
NP_440886.1_7 Reverse -334 -344 7.94438 0.0805
NP_440886.1_7 Reverse -178 -188 4.99446 0.205
NP_440828.1_4 Forward -244 -225 -7.3761 0.285
NP_442614.1_2 Forward -344 -330 5.70279 0.298
NP_442072.1_9 Forward -345 -327 -20.237 0.204
NP_442072.1_9 Reverse -334 -352 -22.6953 0.253
NP_442022.1_4 Reverse -65 -84 7.17762 0.268
NP_442022.1_4 Reverse -62 -81 6.19431 0.273
NP_440907.2_8 Reverse -336 -346 14.2375 0.0312
NP_442264.1_2 Forward -238 -221 9.47861 0.196
NP_441463.1_3 Reverse -325 -344 -2.95047 0.164
NP_441463.1_5 Forward -345 -331 13.4709 0.188
NP_441626.1_2 Forward -343 -336 15.7721 0.0124
NP_441626.1_2 Reverse -336 -343 15.7721 0.0124
NP_442794.1_1 Forward -348 -336 9.57708 0.0795
NP_442615.1_1 Forward -353 -335 6.60732 0.0344
NP_440387.1_1 Reverse -335 -351 7.33503 0.0282
NP_440855.1_3 Reverse -322 -341 17.3048 0.116
NP_441431.1_2 Reverse -332 -346 8.84875 0.204
NP_441993.1_1 Reverse -65 -84 16.9551 0.0548
NP_441993.1_1 Forward -191 -172 1.65431 0.273
NP_440114.1_10 Forward -344 -330 10.4227 0.148
NP_442323.1_7 Reverse -343 -362 2.45694 0.265
NP_440293.1_3 Reverse -63 -82 -2.85214 0.241
NP_440422.1_10 Reverse -8 -27 12.1469 0.16
NP_441237.1_9 Reverse -360 -370 10.9931 0.207
NP_442743.1_1 Reverse -209 -228 8.94676 0.262
NP_442743.1_4 Reverse -336 -355 -5.21209 0.257
NP_441311.1_2 Forward -350 -336 13.8636 0.229
NP_439910.1_2 Reverse -327 -344 -12.8425 0.103
NP_440457.1_1 Forward -232 -220 5.74217 0.138
NP_440457.1_1 Reverse -331 -343 -0.649339 0.271
NP_440457.1_1 Reverse -77 -89 -1.14099 0.294
NP_440798.1_6 Reverse -336 -349 5.91914 0.14
NP_441801.1_4 Forward -69 -59 2.63497 0.29
NP_440801.1_8 Reverse -341 -360 -1.08219 0.275
NP_441984.1_3 Forward -239 -221 12.9988 0.157
NP_441984.1_3 Reverse -331 -349 8.27895 0.232
NP_441332.1_6 Forward -81 -71 12.7117 0.22
NP_442509.1_9 Reverse -335 -345 16.2041 0.00739
NP_442509.1_9 Forward -90 -80 14.7292 0.0242
NP_442509.1_9 Forward -344 -334 8.14104 0.192
NP_441253.1_1 Reverse -326 -345 8.94757 0.205
NP_440554.1_4 Forward -343 -333 8.92815 0.0646
NP_440554.1_4 Reverse -336 -346 7.35486 0.103
NP_441885.1_5 Forward -344 -334 20.9245 0.000538
NP_441885.1_5 Reverse -335 -345 11.4848 0.00668
NP_440478.1_10 Forward -346 -332 11.111 0.193
NP_442703.1_8 Reverse -2 -20 12.0147 0.265
NP_442341.1_7 Reverse -334 -348 19.0758 0.00893
NP_442341.1_7 Forward -345 -331 1.47456 0.288
NP_442341.1_9 Forward -346 -332 7.47213 0.198
NP_442341.1_9 Reverse -174 -188 6.78381 0.215
NP_441756.1_5 Forward -348 -329 -3.63879 0.29
NP_441756.1_5 Forward -231 -212 -4.03212 0.29
NP_442395.2_4 Forward -48 -29 4.62021 0.18
NP_443000.1_7 Reverse -333 -343 19.9412 0.00223
NP_443000.1_7 Forward -346 -336 1.94665 0.226
NP_443059.1_5 Reverse -345 -364 12.9791 0.257
NP_441842.1_10 Forward -351 -337 15.3392 0.044
NP_440275.1_3 Reverse -333 -343 15.123 0.0182
NP_440275.1_3 Forward -346 -336 8.33817 0.0602
NP_440091.1_1 Reverse -331 -343 8.88877 0.0567
NP_442354.1_2 Reverse -69 -88 0.491109 0.299
NP_440679.1_10 Reverse -61 -80 -20.4534 0.284
NP_441122.1_1 Reverse -313 -328 14.3362 0.126
NP_439962.1_4 Forward -352 -333 -0.0988766 0.197
NP_442495.1_4 Reverse -303 -313 12.0747 0.25
NP_440149.1_8 Reverse -335 -354 8.94757 0.0575
NP_442373.1_2 Forward -231 -212 -6.29373 0.227
NP_440216.1_1 Forward -344 -330 17.7975 0.00129
NP_440216.1_1 Reverse -335 -349 7.37441 0.00942
NP_440216.1_1 Forward -90 -76 -1.47537 0.0328
NP_440172.1_1 Forward -344 -334 15.0247 0.00945
NP_440172.1_1 Reverse -335 -345 8.73149 0.0586
NP_442015.1_10 Forward -348 -335 11.524 0.0372
NP_442015.1_10 Reverse -331 -344 2.87088 0.187
NP_442015.1_10 Forward -40 -27 -0.964025 0.289
NP_441226.1_7 Forward -343 -336 14.4934 0.0123
NP_441226.1_7 Reverse -336 -343 14.4934 0.0123
NP_441226.1_7 Forward -124 -117 6.52862 0.253
NP_441111.1_7 Forward -343 -335 18.7023 0.00294
NP_441111.1_7 Reverse -336 -344 18.7023 0.00294
NP_441766.1_2 Forward -344 -335 17.5026 0.00297
NP_441766.1_2 Reverse -335 -344 17.5026 0.00297
NP_442417.1_5 Reverse -335 -349 18.5841 0.0203
NP_440416.1_1 Forward -344 -325 5.211 0.0588
NP_440416.1_9 Forward -351 -332 -5.50708 0.0803
NP_440416.1_9 Reverse -63 -82 -20.4534 0.285
NP_443052.1_8 Reverse -325 -344 -1.18052 0.0784
NP_443052.1_9 Forward -84 -65 -1.86883 0.231
NP_440072.1_5 Forward -228 -210 5.82068 0.236
NP_442154.1_1 Forward -230 -212 -7.749 0.148
NP_442154.1_1 Reverse -66 -84 -11.8789 0.217
NP_442154.1_1 Reverse -63 -81 -14.9272 0.218
NP_442154.1_1 Forward -227 -209 -15.5171 0.22
NP_442154.1_1 Reverse -57 -75 -18.5654 0.282
NP_442226.1_8 Reverse -21 -31 14.828 0.256
NP_440261.1_5 Forward -308 -295 -1.16069 0.0662
NP_440261.1_5 Forward -343 -330 -2.73398 0.0924
NP_440261.1_5 Reverse -336 -349 -10.3055 0.201
NP_440261.1_5 Forward -73 -60 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCCCTACTTCATGGAAATGTACTGCCTCTGGCTCAATGCCGTGGACTTCCCCTTCGGCGATCGCCAGTTGATGGAAAATGGCCAAACTCCAGCGACTGACCCGAGCAGGTAAATTAGCCTGTTTGATTAACTGTTCTATTTCTGGTAGATGACGCATTCCATGGTGACCAGGGCCGTGGGAGTGGTGGTCATTAAGGAGTTTTACTTCTACCTTGGTGGCGGCCTGACCTTGTTTTTGCACCAGACCCGCCGTCAAGCGATATTCATCTGTTAAACCCAACGGAGCCAGTTTCTCCATCAGGTATTCTAGGGGAACCCCCGCCGACACCAAAGCCCCCAGGCACATATCACCAGAAATCCCTGTGGGACAGTCAAAATAGGCAATCAAACCCATAAAAA

CDS

ATGGCCACCTTTTATAATCTTCACCCCGAAACCCCCCAACAACGCACTGTGGAAATGATTTGCAAAAGTCTCCGCCAGGGGGCAATTATGCTTTACCCCACCGACACGGTCTATGCCATCGGTTGTGACCTCAACGATAAAAATGCCGTTCAACGGGTTAGACAACTGAAGCAACTCTCCAATAATAAACCGTTAACGTTTTTGTGTTCGTCCCTGTCTAACATTGCGGAATATGCAGTGGTGGCGGACGATGCCTATCGACTCATGCGTAAGTTAATACCTGGACCCTATACTTTTCTTCTTCCGGCCACCAAGCAAGTGCCCAAGCTAGTGGTGGAGCCGAAGCGAAAAACCACCGGCATAAGGGTGCCCGATCGCCCTATTTGCCAAGAAATTCTGCAAAGCCTGGGCAATCCGATCATCTCCACCTCTGCCCATTTGCCGGATCAAGATGAGTTTGTTATGGCGGAAAAGGCGAAACTGTTTGACCTATTTGACAAATTGGTGGACATCATCATTGACGATGACCGGGAGCCGGGCTATCAAACTTCCAGCATTATTGATTTCACCGACAAAGAACCCAAAGTGGTGCGGGAAGGGCTGGGTTGGGAAACCCTGCGAGATTTGTTTTAG

Protein

MATFYNLHPETPQQRTVEMICKSLRQGAIMLYPTDTVYAIGCDLNDKNAVQRVRQLKQLSNNKPLTFLCSSLSNIAEYAVVADDAYRLMRKLIPGPYTFLLPATKQVPKLVVEPKRKTTGIRVPDRPICQEILQSLGNPIISTSAHLPDQDEFVMAEKAKLFDLFDKLVDIIIDDDREPGYQTSSIIDFTDKEPKVVREGLGWETLRDLF