Your browser is old and dusty. Try Google Chrome!

Details for sll0200

ORF sll0200
Accession NP_442156.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100s: 2524547 - 2525492]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -207 -221 7.86607 0.0956
NP_440795.1_7 Forward -214 -207 14.6904 0.0123
NP_440795.1_7 Reverse -207 -214 14.6904 0.0123
NP_442291.1_5 Forward -216 -200 3.59845 0.107
NP_441453.1_4 Forward -215 -207 16.539 0.00633
NP_441453.1_4 Reverse -206 -214 7.8859 0.0536
NP_442151.1_6 Reverse -206 -220 16.0275 0.0187
NP_440561.1_5 Forward -224 -205 12.3892 0.278
NP_440226.1_1 Forward -215 -196 5.99764 0.139
NP_442173.1_1 Reverse -207 -215 15.4574 0.00633
NP_442173.1_1 Forward -214 -206 14.1791 0.0165
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_443027.1_4 Reverse -204 -214 16.303 0.0437
NP_443027.1_4 Forward -248 -238 7.15819 0.244
NP_441812.1_3 Forward -216 -202 15.6342 0.0985
NP_442975.1_10 Reverse -202 -216 11.897 0.0482
NP_440784.1_7 Forward -214 -207 15.9687 0.0123
NP_440784.1_7 Reverse -207 -214 15.9687 0.0123
NP_442062.1_8 Forward -215 -205 9.61647 0.0587
NP_442062.1_8 Reverse -206 -216 7.84651 0.0871
NP_441859.1_3 Forward -216 -197 5.11187 0.206
NP_442972.1_1 Reverse -156 -174 13.6329 0.22
NP_442972.1_2 Reverse -141 -155 13.9619 0.179
NP_440304.1_4 Reverse -204 -214 9.12481 0.0626
NP_440304.1_4 Forward -217 -207 1.84832 0.299
NP_442242.1_4 Forward -214 -207 14.3954 0.0124
NP_442242.1_4 Reverse -207 -214 14.3954 0.0124
NP_440044.1_8 Forward -214 -195 18.6823 0.0159
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_440916.1_1 Forward -97 -83 10.4227 0.206
NP_441619.1_8 Forward -221 -207 8.3571 0.246
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_442110.1_7 Forward -215 -201 0.982901 0.241
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_441083.1_5 Reverse -206 -216 10.9931 0.017
NP_441083.1_5 Forward -215 -205 1.55333 0.204
NP_442827.1_8 Forward -223 -204 0.195343 0.214
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441738.1_2 Forward -213 -206 11.5435 0.084
NP_441738.1_2 Reverse -184 -191 8.1019 0.204
NP_441738.1_2 Reverse -108 -115 6.03696 0.295
NP_441558.1_5 Reverse -204 -223 11.0125 0.0879
NP_440209.1_1 Forward -215 -207 18.1123 0.00295
NP_440209.1_1 Reverse -206 -214 8.47588 0.0457
NP_442889.1_8 Reverse -203 -217 17.7968 0.0149
NP_441770.1_5 Reverse -198 -217 0.786102 0.243
NP_440178.1_7 Forward -216 -197 -12.0953 0.112
NP_442570.1_3 Reverse -315 -334 -8.85033 0.294
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_442111.1_4 Forward -216 -202 1.76955 0.294
NP_440906.1_5 Forward -214 -207 15.8704 0.0124
NP_440906.1_5 Reverse -207 -214 15.8704 0.0124
NP_440747.1_10 Forward -218 -206 5.15219 0.0179
NP_440747.1_10 Reverse -203 -215 -11.7607 0.142
NP_441130.1_10 Forward -217 -203 8.16106 0.14
NP_441486.1_1 Reverse -203 -217 4.03116 0.0508
NP_442634.1_4 Forward -217 -203 -3.63866 0.161
NP_442634.1_4 Forward -193 -179 -5.50694 0.258
NP_441639.1_3 Forward -216 -197 3.34271 0.264
NP_441014.1_10 Reverse -316 -335 1.27698 0.23
NP_442848.1_1 Reverse -200 -214 3.44117 0.133
NP_443018.1_3 Forward -214 -207 14.8871 0.0123
NP_443018.1_3 Reverse -207 -214 14.8871 0.0123
NP_443018.1_3 Reverse -324 -331 10.7572 0.0907
NP_443018.1_3 Forward -331 -324 4.56234 0.241
NP_441634.1_8 Forward -217 -203 5.40779 0.114
NP_440376.1_1 Forward -215 -206 9.73449 0.0365
NP_440376.1_1 Reverse -206 -215 9.63616 0.0385
NP_440376.1_1 Forward -361 -352 -0.393597 0.289
NP_441588.1_4 Reverse -208 -218 15.9097 0.0369
NP_442958.1_3 Forward -343 -324 -2.26216 0.293
NP_442530.1_2 Forward -103 -93 16.893 0.178
NP_442658.1_1 Reverse -204 -214 14.0409 0.0273
NP_442658.1_1 Forward -217 -207 6.76441 0.214
NP_442782.1_2 Reverse -237 -251 0.687908 0.286
NP_440656.1_8 Reverse -195 -214 -6.58872 0.245
NP_441414.1_9 Reverse -206 -225 3.34271 0.0594
NP_441414.1_9 Forward -215 -196 -4.6221 0.158
NP_441958.1_5 Reverse -205 -215 11.3864 0.0074
NP_441958.1_5 Forward -216 -206 3.12662 0.0364
NP_439905.1_1 Reverse -324 -337 15.7522 0.0807
NP_439905.1_1 Reverse -207 -220 8.86907 0.228
NP_441097.1_2 Reverse -333 -350 2.89044 0.293
NP_439990.1_5 Reverse -318 -331 7.88576 0.185
NP_439990.1_5 Forward -220 -207 7.6891 0.186
NP_442911.1_2 Reverse -196 -215 2.26107 0.0521
NP_440153.1_5 Forward -214 -200 7.07942 0.173
NP_442064.1_1 Reverse -313 -332 -8.35868 0.259
NP_442064.1_4 Reverse -313 -332 7.57013 0.242
NP_440993.1_2 Reverse -201 -217 8.80999 0.133
NP_440496.1_5 Forward -187 -168 13.7982 0.224
NP_441429.1_4 Reverse -132 -151 16.1249 0.134
NP_441294.1_7 Reverse -202 -216 14.914 0.033
NP_441294.1_7 Reverse -209 -223 9.34661 0.249
NP_441646.1_1 Forward -222 -203 3.34271 0.207
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_441000.1_6 Forward -216 -202 -5.11362 0.261
NP_440147.1_4 Forward -217 -204 10.8357 0.0353
NP_441550.1_8 Forward -217 -207 14.6309 0.0132
NP_441550.1_8 Reverse -204 -214 14.2375 0.0168
NP_441916.1_7 Forward -215 -205 9.61647 0.0333
NP_441916.1_7 Reverse -206 -216 2.04498 0.265
NP_441916.1_7 Reverse -237 -247 1.16001 0.293
NP_441041.1_7 Reverse -203 -215 16.4551 0.015
NP_442642.1_9 Reverse -199 -216 7.61033 0.192
NP_442396.1_5 Forward -219 -206 13.1956 0.0913
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_441725.1_5 Forward -214 -204 7.64985 0.0904
NP_441725.1_5 Reverse -207 -217 2.04498 0.115
NP_439966.1_7 Reverse -204 -214 11.2876 0.0688
NP_439966.1_7 Forward -217 -207 7.25606 0.15
NP_439966.1_9 Reverse -204 -213 9.24284 0.253
NP_442941.1_3 Reverse -207 -217 11.0914 0.0116
NP_442941.1_3 Forward -214 -204 1.55333 0.15
NP_440289.1_2 Reverse -203 -216 2.67422 0.0907
NP_442281.1_1 Forward -251 -237 7.86545 0.0907
NP_442281.1_1 Reverse -201 -215 7.57046 0.0969
NP_442281.1_1 Forward -220 -206 5.1122 0.169
NP_441334.1_7 Reverse -204 -223 -10.3253 0.12
NP_442012.1_2 Forward -334 -315 9.83255 0.156
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_441644.1_6 Forward -215 -205 16.5975 0.00319
NP_441644.1_6 Reverse -206 -216 8.04271 0.11
NP_443049.1_6 Forward -216 -206 11.2506 0.269
NP_442029.1_6 Forward -337 -318 3.6377 0.28
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_440929.1_8 Forward -215 -206 17.4043 0.00289
NP_440929.1_8 Reverse -206 -215 17.4043 0.00289
NP_442933.1_2 Reverse -135 -153 12.3204 0.227
NP_442933.1_10 Forward -215 -206 9.04618 0.063
NP_442933.1_10 Reverse -206 -215 8.94785 0.0643
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_441751.2_8 Reverse -207 -221 -4.4253 0.173
NP_441751.2_8 Forward -214 -200 -5.60527 0.223
NP_442554.1_8 Forward -214 -204 15.8113 0.00783
NP_442554.1_8 Reverse -207 -217 15.3197 0.00882
NP_442554.1_8 Forward -331 -321 2.63497 0.265
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_441762.1_7 Forward -216 -204 -4.77924 0.182
NP_441762.1_7 Reverse -205 -217 -6.94252 0.284
NP_442142.1_4 Reverse -203 -216 4.64028 0.214
NP_442292.1_1 Reverse -207 -216 18.486 0.00229
NP_442292.1_1 Forward -214 -205 16.9127 0.00594
NP_442476.1_6 Reverse -207 -221 2.94952 0.169
NP_442016.1_10 Forward -398 -379 5.70265 0.277
NP_442381.1_8 Reverse -203 -222 -5.11376 0.141
NP_443009.1_5 Forward -216 -205 13.4312 0.0327
NP_443009.1_5 Reverse -105 -116 3.40144 0.296
NP_441715.1_4 Reverse -207 -217 7.94484 0.107
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_441198.1_5 Forward -213 -200 12.8017 0.216
NP_441198.1_8 Reverse -204 -214 13.955 0.101
NP_440464.1_10 Reverse -207 -217 13.0082 0.169
NP_441468.1_1 Forward -214 -207 15.8704 0.0124
NP_441468.1_1 Reverse -207 -214 15.8704 0.0124
NP_441468.1_1 Forward -331 -324 4.07068 0.263
NP_441673.1_1 Forward -215 -206 11.1111 0.0121
NP_441673.1_1 Reverse -206 -215 11.0128 0.018
NP_442868.1_6 Forward -217 -207 9.81313 0.038
NP_442868.1_6 Forward -334 -324 5.97822 0.132
NP_442868.1_6 Reverse -204 -214 -0.314959 0.284
NP_442427.1_8 Reverse -197 -216 7.47261 0.214
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_442505.1_2 Forward -318 -299 13.9214 0.252
NP_442050.1_5 Reverse -204 -214 16.5975 0.00812
NP_442050.1_5 Forward -217 -207 7.64939 0.243
NP_440385.1_6 Reverse -65 -84 13.4162 0.235
NP_440558.1_2 Reverse -314 -333 -5.40875 0.258
NP_441878.1_6 Forward -216 -206 0.668351 0.139
NP_441878.1_6 Reverse -205 -215 0.668351 0.139
NP_441036.1_8 Reverse -205 -215 14.7297 0.0187
NP_441557.1_5 Reverse -206 -215 17.4043 0.0023
NP_441557.1_5 Forward -215 -206 10.8161 0.00464
NP_441308.1_8 Reverse -204 -214 10.9931 0.22
NP_441564.1_2 Reverse -236 -255 -3.04881 0.223
NP_442183.1_1 Forward -215 -201 18.4858 0.00758
NP_440861.1_2 Reverse -167 -186 11.9368 0.27
NP_442347.1_2 Reverse -207 -216 12.4878 0.056
NP_442347.1_2 Forward -93 -84 4.22796 0.284
NP_441037.1_4 Reverse -204 -214 15.5041 0.028
NP_441037.1_4 Forward -217 -207 7.9999 0.237
NP_442317.1_6 Forward -220 -201 4.62101 0.246
NP_441633.1_3 Forward -217 -204 1.10092 0.109
NP_440136.1_2 Forward -214 -207 15.9687 0.0123
NP_440136.1_2 Reverse -207 -214 15.9687 0.0123
NP_442998.1_5 Reverse -86 -96 8.92815 0.26
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_442998.1_10 Forward -213 -206 5.84064 0.235
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440299.1_1 Forward -219 -206 4.44361 0.207
NP_441799.1_1 Forward -219 -205 14.7486 0.0222
NP_441007.1_10 Reverse -201 -214 11.3273 0.0646
NP_441007.1_10 Forward -220 -207 10.5407 0.0656
NP_440256.1_1 Forward -218 -199 -6.1954 0.205
NP_440256.1_1 Forward -249 -230 -7.08038 0.228
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_442007.1_8 Reverse -105 -123 11.7197 0.258
NP_441512.1_4 Reverse -202 -221 9.93088 0.237
NP_441704.1_8 Forward -226 -207 6.09517 0.268
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_441464.1_8 Forward -215 -201 9.14437 0.192
NP_442386.1_9 Forward -216 -207 13.8639 0.0289
NP_442386.1_9 Forward -333 -324 10.029 0.142
NP_442386.1_9 Reverse -205 -214 5.11253 0.266
NP_441750.1_7 Reverse -342 -352 14.533 0.254
NP_441340.1_5 Forward -214 -207 15.6737 0.0124
NP_441340.1_5 Reverse -207 -214 15.6737 0.0124
NP_441340.1_5 Reverse -324 -331 3.97235 0.274
NP_441340.1_9 Forward -235 -225 16.8354 0.194
NP_441340.1_9 Reverse -122 -132 7.38756 0.27
NP_442484.1_2 Forward -226 -207 1.37609 0.236
NP_440586.1_8 Forward -214 -207 13.2151 0.026
NP_440586.1_8 Reverse -207 -214 13.2151 0.026
NP_442251.1_6 Forward -214 -207 15.2804 0.0124
NP_442251.1_6 Reverse -207 -214 15.2804 0.0124
NP_440684.1_9 Forward -221 -207 9.63603 0.217
NP_441262.1_3 Reverse -206 -213 14.8871 0.0223
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_443051.1_1 Reverse -205 -214 17.5026 0.0066
NP_443051.1_1 Forward -216 -207 10.4228 0.00754
NP_439996.1_6 Forward -225 -206 8.7879 0.242
NP_439943.1_1 Forward -142 -123 -9.14533 0.28
NP_440372.1_2 Forward -214 -207 16.3621 0.0124
NP_440372.1_2 Reverse -207 -214 16.3621 0.0124
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_439977.1_5 Forward -221 -202 -1.57384 0.256
NP_441572.1_7 Forward -338 -319 -6.58872 0.296
NP_440267.1_2 Reverse -201 -215 11.7987 0.125
NP_442384.1_10 Reverse -206 -219 6.90245 0.092
NP_442114.1_8 Reverse -141 -155 5.01387 0.245
NP_442790.1_4 Forward -224 -205 -15.6352 0.295
NP_442262.1_10 Forward -214 -207 14.1988 0.0123
NP_442262.1_10 Reverse -207 -214 14.1988 0.0123
NP_442262.1_10 Reverse -324 -331 9.87221 0.164
NP_441689.1_5 Forward -217 -207 5.78111 0.197
NP_441689.1_5 Reverse -180 -190 5.48612 0.251
NP_440344.1_10 Reverse -199 -216 -8.0243 0.121
NP_442123.1_3 Forward -215 -196 17.7974 0.0758
NP_440189.1_10 Forward -226 -207 10.6192 0.207
NP_440562.1_5 Forward -366 -347 3.14605 0.261
NP_441965.1_10 Reverse -203 -219 4.0901 0.249
NP_440297.1_9 Forward -214 -204 -0.0199663 0.282
NP_440297.1_9 Reverse -207 -217 -0.118297 0.282
NP_441592.1_4 Reverse -206 -225 6.78429 0.124
NP_441896.1_5 Reverse -242 -249 12.2322 0.273
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_440999.1_9 Reverse -202 -216 3.14618 0.135
NP_440888.1_2 Forward -215 -201 5.01387 0.298
NP_440600.1_4 Reverse -198 -216 2.0841 0.125
NP_440491.1_1 Reverse -203 -222 7.50176 0.265
NP_442277.1_7 Reverse -160 -176 -0.279674 0.221
NP_440575.1_8 Reverse -308 -327 10.2259 0.0863
NP_441543.1_2 Reverse -207 -216 16.9127 0.00359
NP_441543.1_2 Forward -214 -205 6.39124 0.153
NP_442845.1_2 Forward -221 -207 9.34103 0.177
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_441469.1_8 Reverse -205 -214 6.98123 0.227
NP_441469.1_8 Forward -216 -207 6.48957 0.227
NP_442315.1_1 Reverse -332 -350 13.3922 0.126
NP_442337.1_8 Reverse -312 -331 2.45773 0.217
NP_442578.1_7 Forward -214 -207 14.5921 0.026
NP_442578.1_7 Reverse -207 -214 14.5921 0.026
NP_441462.1_2 Forward -215 -205 11.3864 0.00425
NP_441462.1_2 Reverse -206 -216 1.74999 0.0811
NP_441462.1_4 Forward -354 -335 -4.13045 0.237
NP_443062.1_1 Forward -215 -197 14.6889 0.0444
NP_440519.1_6 Reverse -318 -332 9.93102 0.29
NP_442204.1_1 Reverse -233 -244 5.8602 0.186
NP_442204.1_5 Forward -225 -206 4.916 0.16
NP_440454.1_2 Reverse -172 -186 10.8977 0.291
NP_440516.1_8 Forward -215 -206 9.53783 0.0136
NP_440516.1_8 Reverse -206 -215 7.07956 0.0867
NP_441033.1_2 Reverse -196 -215 -9.24366 0.293
NP_442428.1_5 Forward -214 -207 15.8704 0.0124
NP_442428.1_5 Reverse -207 -214 15.8704 0.0124
NP_442428.1_5 Forward -331 -324 4.46401 0.267
NP_442120.1_10 Reverse -306 -325 -11.8986 0.265
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_440673.1_3 Reverse -325 -332 9.67555 0.179
NP_440673.1_3 Forward -213 -206 5.34899 0.298
NP_441052.1_2 Reverse -206 -216 11.3864 0.0285
NP_441052.1_2 Forward -215 -205 0.668351 0.256
NP_442219.1_8 Forward -362 -343 13.192 0.153
NP_442219.1_9 Reverse -207 -216 17.7976 0.00718
NP_440436.1_4 Reverse -207 -216 17.2072 0.00233
NP_441884.1_8 Forward -216 -197 -9.14533 0.268
NP_441884.1_9 Reverse -203 -222 -23.6 0.284
NP_441719.1_4 Forward -214 -207 16.3621 0.0124
NP_441719.1_4 Reverse -207 -214 16.3621 0.0124
NP_441733.1_10 Reverse -203 -216 8.86907 0.132
NP_441004.1_1 Forward -338 -319 -12.5869 0.247
NP_442366.1_5 Forward -218 -208 15.4175 0.0374
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_442206.1_10 Forward -215 -200 3.12649 0.191
NP_441851.1_10 Forward -216 -206 15.6147 0.00791
NP_441851.1_10 Reverse -205 -215 6.96153 0.151
NP_442939.1_5 Reverse -258 -272 18.9367 0.129
NP_442515.1_1 Forward -216 -202 3.63784 0.115
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_441349.1_10 Reverse -196 -215 4.62101 0.0521
NP_441409.1_5 Forward -98 -79 16.7149 0.153
NP_441409.1_6 Forward -221 -202 -9.93197 0.196
NP_440432.1_9 Forward -214 -199 6.17475 0.0477
NP_440474.1_8 Forward -214 -200 11.307 0.112
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_440431.1_3 Reverse -168 -187 -9.24366 0.242
NP_440431.1_4 Reverse -146 -165 -8.45146 0.275
NP_442450.1_5 Forward -217 -207 7.55152 0.13
NP_441570.1_1 Forward -215 -197 0.0191479 0.0424
NP_440078.1_4 Forward -226 -207 11.4058 0.237
NP_441078.1_4 Forward -215 -206 9.93116 0.0203
NP_441078.1_4 Reverse -206 -215 9.83282 0.0226
NP_442729.1_8 Forward -219 -206 7.59077 0.146
NP_441528.1_2 Forward -342 -323 6.29183 0.297
NP_440526.1_3 Forward -214 -203 10.0879 0.0669
NP_440526.1_3 Reverse -207 -218 1.04151 0.267
NP_441432.1_8 Forward -216 -207 16.8143 0.00595
NP_441432.1_8 Reverse -205 -214 6.98123 0.112
NP_441432.1_8 Forward -333 -324 5.21127 0.185
NP_442320.1_8 Forward -221 -207 -2.65535 0.0926
NP_442320.1_8 Reverse -200 -214 -3.73699 0.131
NP_442344.1_7 Reverse -207 -226 11.0125 0.0298
NP_441732.1_2 Reverse -345 -361 -17.641 0.281
NP_440629.1_6 Forward -352 -333 12.8958 0.277
NP_440321.1_1 Reverse -334 -351 15.5751 0.27
NP_440760.1_1 Reverse -206 -225 2.45773 0.0225
NP_442510.1_5 Forward -224 -205 16.9124 0.171
NP_442400.1_10 Reverse -138 -151 7.89211 0.281
NP_442489.1_7 Forward -215 -206 10.4228 0.0151
NP_442489.1_7 Reverse -206 -215 10.3245 0.0193
NP_440559.1_1 Reverse -207 -216 17.4043 0.00658
NP_440559.1_1 Forward -214 -205 7.76787 0.0918
NP_441659.2_8 Forward -215 -205 17.5813 0.0024
NP_441659.2_8 Reverse -206 -216 8.63316 0.0405
NP_442913.1_9 Forward -221 -202 9.73422 0.22
NP_442913.1_10 Reverse -197 -216 15.2408 0.0177
NP_442913.1_10 Forward -224 -205 -5.21209 0.26
NP_440779.1_5 Forward -215 -198 2.89044 0.0962
NP_442346.1_5 Forward -216 -206 15.418 0.00627
NP_442346.1_5 Forward -333 -323 8.04317 0.149
NP_442346.1_5 Reverse -205 -215 6.8632 0.188
NP_440545.1_3 Reverse -345 -362 -1.33779 0.167
NP_441833.1_4 Forward -214 -207 15.9687 0.0124
NP_441833.1_4 Reverse -207 -214 15.9687 0.0124
NP_441329.1_6 Reverse -167 -186 -1.57604 0.293
NP_442162.1_9 Forward -214 -207 16.2637 0.0124
NP_442162.1_9 Reverse -207 -214 16.2637 0.0124
NP_442199.1_5 Reverse -198 -217 -6.68705 0.28
NP_442140.1_3 Reverse -207 -217 12.2714 0.0632
NP_442140.1_3 Forward -214 -204 8.92815 0.117
NP_440875.1_9 Forward -213 -203 15.2829 0.0295
NP_441813.1_5 Forward -217 -207 8.63316 0.0367
NP_441813.1_5 Reverse -204 -214 7.94484 0.0517
NP_440590.1_4 Reverse -207 -220 7.88576 0.0493
NP_440567.1_1 Reverse -207 -221 12.6843 0.022
NP_442497.1_10 Forward -214 -205 15.7327 0.0087
NP_442497.1_10 Reverse -207 -216 10.4228 0.0087
NP_440821.1_4 Reverse -204 -214 10.2065 0.0163
NP_440821.1_4 Forward -217 -207 9.41981 0.0286
NP_441239.1_9 Reverse -204 -216 14.887 0.0247
NP_442639.1_5 Forward -339 -320 22.8122 0.0413
NP_441727.1_3 Reverse -199 -218 4.81767 0.262
NP_441727.1_5 Forward -111 -92 15.9825 0.292
NP_441892.1_1 Reverse -197 -214 -5.27103 0.276
NP_442270.1_9 Forward -226 -207 -10.9153 0.265
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_443035.1_6 Reverse -270 -289 14.8466 0.208
NP_441617.1_6 Forward -222 -203 5.40766 0.142
NP_440546.1_4 Forward -215 -205 6.65249 0.288
NP_440462.1_6 Reverse -204 -214 10.7964 0.0396
NP_440462.1_6 Forward -283 -273 1.74999 0.294
NP_440462.1_6 Forward -217 -207 1.35667 0.294
NP_440868.1_4 Forward -219 -207 8.10212 0.0602
NP_440868.1_4 Reverse -202 -214 -0.846001 0.282
NP_442499.1_1 Reverse -207 -226 4.916 0.226
NP_441084.1_6 Reverse -204 -218 13.7072 0.125
NP_442039.1_4 Forward -214 -207 15.1821 0.0124
NP_442039.1_4 Reverse -207 -214 15.1821 0.0124
NP_441811.1_8 Forward -221 -207 12.4876 0.207
NP_440825.1_7 Reverse -207 -217 12.9096 0.152
NP_442696.1_2 Forward -216 -198 9.55725 0.244
NP_442837.1_3 Forward -214 -207 15.7721 0.0124
NP_442837.1_3 Reverse -207 -214 15.7721 0.0124
NP_442053.1_1 Forward -215 -206 9.34117 0.0666
NP_442053.1_1 Reverse -206 -215 8.84951 0.072
NP_440505.1_3 Forward -217 -207 9.22315 0.122
NP_440505.1_3 Reverse -204 -214 5.5849 0.222
NP_440505.1_3 Reverse -340 -350 5.28991 0.236
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_441102.1_6 Reverse -302 -321 11.0125 0.292
NP_442532.1_7 Forward -215 -201 12.0943 0.114
NP_441408.2_7 Reverse -204 -223 -0.688862 0.234
NP_440914.1_1 Forward -215 -205 14.0802 0.0188
NP_440914.1_1 Forward -332 -322 9.68861 0.178
NP_440914.1_1 Reverse -206 -216 8.51751 0.186
NP_441011.1_8 Forward -214 -205 8.94785 0.141
NP_441011.1_8 Reverse -207 -216 8.25953 0.144
NP_442533.1_1 Reverse -334 -353 -4.81876 0.151
NP_442533.1_6 Forward -215 -206 7.86621 0.0862
NP_442533.1_6 Reverse -206 -215 7.37455 0.0898
NP_441482.1_7 Forward -221 -207 -10.8168 0.216
NP_439944.1_9 Forward -214 -204 15.5163 0.0177
NP_439944.1_9 Reverse -207 -217 10.5014 0.0887
NP_441028.1_6 Forward -184 -174 4.30615 0.278
NP_440116.1_8 Forward -214 -195 -8.35868 0.253
NP_441527.1_4 Reverse -150 -169 -7.78302 0.237
NP_441527.1_4 Reverse -137 -156 -10.5523 0.272
NP_441527.1_8 Reverse -201 -220 1.76941 0.279
NP_442492.1_2 Forward -215 -196 13.6675 0.0692
NP_441602.1_3 Forward -220 -201 2.16274 0.202
NP_441106.1_1 Forward -216 -207 9.63616 0.0311
NP_441106.1_1 Reverse -205 -214 9.34117 0.0333
NP_439903.1_6 Reverse -203 -222 5.80018 0.176
NP_441286.1_1 Forward -216 -204 5.54551 0.0259
NP_441286.1_1 Reverse -205 -217 2.20226 0.0693
NP_440670.1_8 Forward -215 -206 16.3227 0.00291
NP_440670.1_8 Reverse -206 -215 15.1427 0.00768
NP_441705.1_3 Reverse -327 -346 -6.39206 0.291
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_439995.1_5 Forward -225 -206 5.01433 0.282
NP_442072.1_9 Reverse -181 -199 -22.4003 0.234
NP_442072.1_9 Forward -216 -198 -22.7936 0.259
NP_440907.2_8 Forward -214 -204 17.2858 0.00883
NP_440907.2_8 Reverse -207 -217 7.64939 0.117
NP_442264.1_2 Forward -336 -319 6.82368 0.25
NP_441021.1_1 Reverse -207 -226 -11.9969 0.279
NP_440841.1_4 Reverse -204 -223 -11.3086 0.3
NP_441463.1_2 Reverse -259 -277 4.6956 0.177
NP_441463.1_3 Reverse -196 -215 -0.0988766 0.132
NP_441626.1_2 Forward -214 -207 15.7721 0.0124
NP_441626.1_2 Reverse -207 -214 15.7721 0.0124
NP_442794.1_1 Forward -219 -207 9.28209 0.0795
NP_442794.1_1 Forward -336 -324 3.18557 0.286
NP_442615.1_1 Forward -224 -206 6.41066 0.0348
NP_442615.1_1 Reverse -197 -215 -4.40575 0.185
NP_441962.1_4 Forward -220 -201 -7.67036 0.192
NP_440387.1_1 Reverse -206 -222 11.2683 0.0176
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_441431.1_2 Reverse -203 -217 6.48882 0.269
NP_441488.1_8 Forward -220 -206 9.04542 0.169
NP_440114.1_10 Forward -215 -201 16.8142 0.0145
NP_441817.1_3 Reverse -195 -214 17.0107 0.0481
NP_440766.1_5 Reverse -85 -97 8.03776 0.286
NP_441237.1_9 Reverse -207 -217 14.828 0.0242
NP_442930.1_1 Forward -98 -88 11.5826 0.258
NP_440987.1_4 Reverse -124 -143 5.70265 0.198
NP_440798.1_6 Forward -214 -201 0.314277 0.274
NP_440054.1_4 Reverse -198 -217 12.3892 0.181
NP_442509.1_9 Reverse -106 -116 10.0093 0.192
NP_440554.1_4 Forward -214 -204 16.6963 0.0189
NP_441885.1_5 Reverse -206 -216 11.0914 0.00874
NP_441885.1_5 Forward -215 -205 2.24165 0.0822
NP_442703.1_4 Reverse -206 -225 6.78348 0.238
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_443000.1_7 Forward -217 -207 10.3048 0.0345
NP_443000.1_7 Reverse -204 -214 1.74999 0.229
NP_441842.1_10 Forward -222 -208 11.8976 0.115
NP_440275.1_3 Reverse -204 -214 18.7612 0.0082
NP_440275.1_3 Forward -217 -207 8.04317 0.0602
NP_440091.1_1 Reverse -202 -214 10.5604 0.0458
NP_440679.1_5 Reverse -209 -228 7.7676 0.292
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_442214.1_7 Reverse -324 -343 17.0418 0.219
NP_441105.1_3 Reverse -195 -214 -6.09707 0.229
NP_441105.1_3 Reverse -312 -331 -6.58872 0.236
NP_440216.1_1 Forward -215 -201 -3.73699 0.0881
NP_440216.1_9 Forward -325 -316 13.5694 0.197
NP_440216.1_9 Forward -330 -321 5.70292 0.29
NP_440172.1_1 Forward -215 -205 10.9931 0.0445
NP_440172.1_1 Reverse -206 -216 5.19158 0.149
NP_441226.1_7 Forward -214 -207 14.4934 0.0123
NP_441226.1_7 Reverse -207 -214 14.4934 0.0123
NP_441111.1_7 Reverse -207 -215 18.7023 0.00294
NP_441111.1_7 Forward -214 -206 8.96754 0.0463
NP_441766.1_2 Reverse -206 -215 16.2243 0.0047
NP_441766.1_2 Forward -215 -206 9.14451 0.0337
NP_440416.1_1 Forward -215 -196 -13.5702 0.281
NP_443052.1_8 Reverse -196 -215 -8.06369 0.168
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
NP_440261.1_5 Reverse -207 -220 -10.3055 0.201
NP_440988.1_10 Forward -334 -320 8.09365 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCTCAATCTGTGTGTCGTTGATTTAAGCTTAATGCTACGGGGTCTGTCTCCAACTCCCTCAGCTTCTCGCAATGGCAAGGCAAATAATGTTTCTCTTGCTGAGTAGATGTTCAGGAGGACGGATCGAAAGTCTACAAAACAGATTCTTGACCAAGCCATCTACTTAGAAAAACTTCTGCGTTTTGGCGATCGCATCTTTTAAGCGAGATGCGATTTTTTTGTCCATTAGTTTGTATTTTAATACTCTTTTGTTGTTTGATTTCGTCCAAGCTTTTCTTGGTATGTGGGATCTTCCGTGCCCAAAATTTTATCCCAGAAAGTGAAATATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGAATGTTAA

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKNYVIEKETGRNELSTIEC