Your browser is old and dusty. Try Google Chrome!

Details for sll0198

ORF sll0198
Accession NP_442159.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_1 Forward -399 -381 22.8911 0.0292
NP_441061.1_2 Forward -90 -76 0.0979218 0.218
NP_442151.1_1 Reverse -358 -377 4.916 0.287
NP_441818.1_9 Reverse -62 -81 -9.83364 0.291
NP_442169.1_1 Reverse -346 -365 -2.85214 0.282
NP_443002.1_5 Forward -349 -331 8.96649 0.297
NP_442752.1_4 Reverse -62 -69 10.5605 0.1
NP_442752.1_4 Reverse -76 -83 8.20058 0.127
NP_440061.1_9 Reverse -385 -399 8.45543 0.174
NP_440110.1_8 Reverse -63 -82 -3.54046 0.3
NP_442062.1_3 Reverse -118 -137 4.52268 0.198
NP_440761.1_4 Forward -29 -10 -14.8485 0.273
NP_441035.1_3 Reverse -357 -376 8.25926 0.171
NP_440011.1_1 Reverse -66 -85 16.6174 0.153
NP_440011.1_1 Forward -86 -67 11.8975 0.265
NP_441208.1_9 Forward -74 -60 7.37441 0.222
NP_441594.1_6 Reverse -338 -357 1.76941 0.262
NP_440300.1_5 Reverse -251 -269 15.9491 0.271
NP_440300.1_5 Forward -128 -110 13.5618 0.271
NP_441925.1_2 Reverse -277 -296 1.67108 0.278
NP_441434.1_1 Reverse -111 -125 6.98253 0.291
NP_441713.1_5 Forward -394 -375 7.57094 0.255
NP_442570.1_3 Forward -377 -358 -2.36049 0.212
NP_441716.1_1 Reverse -177 -191 5.30946 0.236
NP_441716.1_1 Reverse -306 -320 3.24451 0.272
NP_441716.1_2 Forward -139 -120 4.40839 0.229
NP_440747.1_10 Reverse -284 -296 -12.1541 0.227
NP_442145.1_4 Forward -125 -106 6.92274 0.216
NP_442145.1_4 Reverse -116 -135 4.34446 0.282
NP_442330.1_3 Forward -180 -161 9.24257 0.237
NP_442634.1_4 Forward -398 -384 2.35953 0.14
NP_442634.1_4 Reverse -74 -88 -5.01529 0.228
NP_441265.1_3 Forward -77 -63 0.392915 0.248
NP_440470.1_5 Reverse -108 -127 5.77684 0.292
NP_440842.1_4 Reverse -117 -136 1.8096 0.238
NP_440842.1_6 Reverse -152 -171 9.53674 0.298
NP_442848.1_5 Forward -370 -352 -0.865831 0.276
NP_440376.1_1 Forward -369 -360 2.16301 0.233
NP_442687.1_7 Forward -25 -15 5.5849 0.194
NP_442687.1_7 Forward -232 -222 4.79825 0.234
NP_442485.1_3 Reverse -376 -395 -1.86883 0.261
NP_440360.1_5 Reverse -178 -197 -2.26216 0.297
NP_442658.1_1 Forward -11 -1 5.38779 0.269
NP_442782.1_2 Reverse -76 -90 9.04604 0.198
NP_440720.1_1 Reverse -56 -75 2.3594 0.263
NP_440607.1_8 Forward -398 -379 0.0977854 0.28
NP_441487.1_9 Reverse -168 -187 -2.26216 0.293
NP_441958.1_3 Forward -180 -161 15.5357 0.218
NP_440203.1_5 Forward -88 -78 13.4509 0.115
NP_441097.1_2 Reverse -72 -89 4.56207 0.278
NP_442690.1_1 Reverse -108 -127 -6.1954 0.165
NP_442690.1_1 Forward -143 -124 -14.0619 0.268
NP_442911.1_1 Reverse -273 -286 15.3405 0.275
NP_442911.1_2 Reverse -52 -71 -8.35868 0.233
NP_440325.1_1 Forward -135 -116 17.0107 0.116
NP_443055.1_6 Reverse -179 -197 1.69003 0.225
NP_442853.1_10 Forward -346 -327 12.1917 0.168
NP_441099.1_5 Forward -81 -62 -1.96717 0.115
NP_441294.1_7 Reverse -203 -217 10.0185 0.213
NP_442771.1_1 Reverse -60 -78 0.510803 0.0953
NP_442771.1_1 Forward -188 -170 -0.865831 0.12
NP_441295.1_4 Reverse -313 -332 -0.197208 0.29
NP_441041.1_4 Forward -178 -159 -1.37718 0.1
NP_441725.1_3 Forward -252 -233 14.1591 0.0559
NP_439966.1_7 Forward -87 -77 7.45273 0.15
NP_441678.1_5 Reverse -60 -79 20.1573 0.187
NP_441087.1_6 Forward -363 -345 -3.12816 0.296
NP_440375.1_6 Reverse -153 -172 9.93088 0.239
NP_441644.1_6 Reverse -222 -232 3.42118 0.282
NP_442215.1_2 Reverse -303 -319 -1.80975 0.189
NP_442215.1_2 Reverse -60 -76 -4.66135 0.237
NP_440096.1_9 Forward -167 -148 18.5034 0.188
NP_442142.1_4 Forward -74 -61 2.28034 0.295
NP_441523.1_6 Forward -76 -57 5.211 0.239
NP_443009.1_5 Forward -72 -61 6.54802 0.157
NP_440730.1_4 Forward -397 -378 -4.13045 0.298
NP_441758.1_10 Forward -127 -108 11.7983 0.0678
NP_442099.1_6 Forward -307 -288 17.2074 0.21
NP_441015.1_10 Reverse -60 -79 -0.295539 0.169
NP_441876.1_9 Reverse -303 -313 10.3043 0.295
NP_441637.1_9 Reverse -55 -73 4.05072 0.245
NP_441764.1_4 Forward -136 -119 13.0374 0.172
NP_442227.1_2 Forward -88 -69 7.37428 0.196
NP_442227.1_2 Forward -92 -73 -1.67217 0.264
NP_443058.1_7 Forward -179 -160 9.53756 0.206
NP_440789.1_1 Reverse -106 -125 14.3549 0.285
NP_441911.1_7 Forward -60 -41 -0.0996487 0.0319
NP_442808.1_1 Forward -359 -349 2.33954 0.27
NP_442542.1_2 Forward -399 -386 4.8375 0.293
NP_440334.1_1 Reverse -110 -129 13.1297 0.298
NP_441048.1_6 Forward -59 -45 15.6723 0.296
NP_440923.1_1 Reverse -105 -123 12.2114 0.238
NP_441878.1_6 Forward -397 -387 -7.29646 0.217
NP_441878.1_6 Reverse -75 -85 -7.68978 0.255
NP_441557.1_8 Forward -82 -72 13.7459 0.204
NP_442066.2_4 Reverse -328 -347 -2.75381 0.215
NP_442777.1_3 Forward -92 -74 9.06482 0.158
NP_442183.1_9 Forward -393 -383 9.51814 0.296
NP_441819.1_5 Reverse -119 -138 9.97848 0.261
NP_440276.1_10 Forward -164 -150 17.9078 0.209
NP_440157.1_5 Forward -338 -319 17.1404 0.265
NP_441037.1_4 Reverse -359 -369 7.12278 0.237
NP_442508.1_8 Forward -324 -307 11.1502 0.256
NP_441633.1_3 Reverse -60 -73 -6.17557 0.238
NP_441728.2_4 Forward -127 -108 11.3154 0.293
NP_442998.1_5 Reverse -358 -368 12.7631 0.159
NP_441007.1_10 Forward -254 -241 -0.37404 0.277
NP_442334.1_10 Forward -187 -168 -16.7168 0.257
NP_440709.1_1 Reverse -115 -134 15.8299 0.0302
NP_440525.1_1 Reverse -105 -124 28.9088 0.000386
NP_440525.1_9 Reverse -85 -104 22.6156 0.0212
NP_440915.1_6 Reverse -72 -86 12.586 0.0208
NP_441296.1_5 Reverse -310 -329 20.354 0.115
NP_440717.1_3 Forward -88 -74 12.6836 0.227
NP_441939.1_3 Forward -369 -350 6.19431 0.248
NP_441199.1_6 Forward -75 -56 -0.983855 0.285
NP_440677.1_6 Reverse -336 -355 8.25926 0.277
NP_440570.1_5 Forward -176 -157 -0.295539 0.262
NP_440570.1_5 Reverse -72 -91 -3.44213 0.289
NP_440168.1_9 Forward -398 -379 -0.197208 0.273
NP_441134.1_6 Forward -180 -162 6.90155 0.276
NP_440586.1_8 Reverse -388 -395 5.64364 0.297
NP_442251.1_6 Reverse -16 -23 7.11894 0.274
NP_442959.1_5 Forward -284 -265 7.7676 0.23
NP_440027.1_3 Reverse -381 -399 2.47668 0.289
NP_439937.1_9 Forward -72 -55 -9.40158 0.188
NP_441595.1_2 Reverse -143 -156 10.3749 0.277
NP_440439.1_1 Reverse -342 -355 1.9859 0.138
NP_440316.1_10 Reverse -75 -85 7.84651 0.245
NP_439977.1_5 Reverse -56 -75 2.3594 0.174
NP_440530.1_2 Forward -352 -333 14.7491 0.216
NP_440163.1_10 Reverse -166 -176 8.73149 0.262
NP_442102.1_3 Forward -81 -62 12.8808 0.229
NP_441896.1_1 Reverse -106 -125 8.35677 0.258
NP_440894.1_10 Reverse -57 -76 7.37428 0.205
NP_440834.1_2 Forward -377 -358 14.7483 0.275
NP_442033.1_10 Reverse -60 -79 -8.06369 0.189
NP_441178.1_6 Forward -94 -75 1.57197 0.28
NP_440982.1_1 Forward -85 -66 6.09517 0.294
NP_443064.1_6 Forward -189 -179 8.6886 0.276
NP_443064.1_8 Reverse -314 -324 14.7292 0.29
NP_440220.1_4 Forward -290 -271 -1.57461 0.264
NP_442204.1_1 Reverse -72 -83 0.845319 0.281
NP_440544.1_5 Reverse -332 -339 13.8024 0.28
NP_442780.1_3 Reverse -118 -137 8.54611 0.258
NP_440516.1_8 Reverse -76 -85 -0.196935 0.185
NP_440818.1_1 Reverse -278 -297 -5.21209 0.295
NP_442120.1_10 Reverse -322 -341 -9.93197 0.247
NP_441052.1_2 Reverse -141 -151 -0.806614 0.299
NP_440992.1_5 Forward -65 -46 11.9854 0.297
NP_442414.1_1 Forward -76 -57 15.3391 0.291
NP_441086.1_3 Reverse -137 -156 13.4409 0.117
NP_442694.1_3 Reverse -60 -78 -4.01242 0.265
NP_442515.1_1 Forward -94 -80 0.88457 0.178
NP_442515.1_1 Forward -72 -58 -4.32697 0.298
NP_440463.1_7 Reverse -304 -318 14.2576 0.296
NP_442689.1_8 Forward -139 -122 -0.354483 0.198
NP_441124.1_5 Forward -132 -122 10.5254 0.286
NP_440431.1_3 Reverse -137 -156 -8.45701 0.234
NP_441031.1_1 Forward -128 -109 15.6921 0.086
NP_441031.1_1 Reverse -102 -121 6.14789 0.278
NP_442006.1_2 Reverse -69 -86 -17.1691 0.27
NP_442006.1_3 Reverse -70 -88 -4.40575 0.29
NP_442443.1_1 Forward -395 -376 -6.29373 0.294
NP_440526.1_3 Reverse -63 -74 6.64635 0.189
NP_440313.1_5 Reverse -222 -240 13.9813 0.214
NP_441057.1_4 Reverse -61 -79 -3.71743 0.297
NP_442727.1_10 Reverse -45 -64 2.75272 0.203
NP_441830.1_10 Reverse -43 -62 19.2723 0.104
NP_440757.1_8 Forward -137 -125 18.9964 0.0961
NP_440757.1_8 Reverse -125 -137 18.4221 0.0961
NP_441800.1_7 Reverse -382 -400 17.5221 0.0398
NP_442346.1_5 Forward -25 -15 7.25653 0.176
NP_440831.1_3 Reverse -358 -377 4.83391 0.298
NP_440486.1_5 Reverse -60 -79 9.0459 0.255
NP_440250.1_4 Reverse -109 -128 6.1935 0.253
NP_441943.1_8 Reverse -279 -298 -4.03212 0.191
NP_442603.1_7 Reverse -62 -76 5.89884 0.269
NP_442828.1_7 Forward -385 -366 2.26107 0.242
NP_441888.1_8 Reverse -343 -362 9.14423 0.29
NP_441050.1_5 Reverse -45 -63 -2.14413 0.277
NP_441050.1_5 Reverse -340 -358 -3.02911 0.286
NP_441329.1_1 Reverse -114 -133 6.82725 0.249
NP_441112.1_6 Forward -53 -34 -3.83545 0.296
NP_440671.1_4 Forward -215 -201 9.2427 0.184
NP_440671.1_4 Forward -382 -368 9.04604 0.187
NP_440671.1_4 Reverse -163 -177 5.01447 0.297
NP_442943.1_1 Reverse -124 -139 4.06266 0.24
NP_440590.1_4 Forward -70 -57 -1.45568 0.22
NP_441239.1_9 Forward -87 -75 13.707 0.0355
NP_440400.1_1 Reverse -381 -400 -2.65624 0.285
NP_441892.1_1 Forward -181 -164 1.31714 0.154
NP_441892.1_1 Forward -205 -188 -2.61609 0.224
NP_440665.1_1 Reverse -157 -176 -15.3402 0.267
NP_442044.1_1 Forward -76 -57 -11.6036 0.271
NP_442193.1_1 Reverse -346 -364 9.75391 0.233
NP_441508.1_1 Forward -122 -103 15.9397 0.101
NP_441508.1_1 Reverse -119 -138 10.2692 0.295
NP_440833.1_6 Forward -60 -46 8.16044 0.277
NP_442138.1_10 Reverse -321 -340 -0.787193 0.162
NP_442565.1_4 Forward -358 -339 -8.65367 0.286
NP_442479.1_9 Forward -399 -380 -12.9802 0.288
NP_441848.1_4 Reverse -268 -284 8.69657 0.288
NP_441926.1_3 Reverse -321 -337 10.3833 0.17
NP_440160.1_3 Forward -327 -308 15.0432 0.159
NP_440505.1_3 Reverse -79 -89 7.25653 0.16
NP_440505.1_7 Reverse -295 -314 4.81767 0.192
NP_442532.1_1 Reverse -92 -106 9.14183 0.284
NP_439981.1_9 Forward -364 -345 18.0924 0.168
NP_442322.1_4 Forward -93 -76 13.0178 0.109
NP_440007.1_9 Reverse -72 -86 1.27789 0.289
NP_441602.1_3 Reverse -57 -76 -1.37718 0.226
NP_441602.1_3 Forward -375 -356 -5.11376 0.278
NP_441972.1_5 Forward -84 -65 0.196116 0.155
NP_441106.1_3 Reverse -104 -123 13.9625 0.16
NP_440828.1_4 Forward -94 -75 -4.91784 0.246
NP_441808.1_8 Forward -393 -374 12.2908 0.213
NP_442893.1_4 Forward -278 -259 -0.689632 0.252
NP_441626.1_5 Reverse -294 -313 14.7491 0.205
NP_442209.1_8 Forward -344 -325 14.5524 0.18
NP_441431.1_3 Forward -202 -183 3.83436 0.263
NP_441993.1_1 Reverse -341 -360 4.57804 0.217
NP_441993.1_1 Reverse -70 -89 4.57804 0.217
NP_441993.1_1 Reverse -59 -78 3.70092 0.23
NP_442805.1_1 Reverse -119 -136 17.6401 0.0323
NP_439988.1_7 Reverse -61 -75 11.7987 0.292
NP_442930.1_1 Forward -59 -49 16.0075 0.19
NP_442867.1_8 Forward -329 -310 4.62101 0.278
NP_440457.1_1 Reverse -72 -84 6.72548 0.113
NP_440142.1_2 Reverse -325 -339 19.7641 0.245
NP_441436.1_2 Reverse -342 -361 -6.39206 0.296
NP_442509.1_9 Reverse -62 -72 6.96107 0.244
NP_440524.1_3 Reverse -159 -178 9.14423 0.28
NP_442514.1_5 Forward -86 -67 -9.44104 0.296
NP_441440.1_8 Reverse -166 -179 16.1456 0.299
NP_442862.1_3 Reverse -43 -60 4.3654 0.29
NP_440649.2_8 Reverse -355 -369 9.04604 0.28
NP_442341.1_7 Forward -72 -58 5.70279 0.148
NP_442341.1_9 Reverse -166 -180 9.04542 0.159
NP_441756.1_5 Reverse -72 -91 -3.73712 0.29
NP_442395.2_4 Forward -91 -72 2.9486 0.213
NP_440191.1_4 Reverse -210 -220 13.8268 0.282
NP_440507.2_3 Forward -80 -61 9.93006 0.213
NP_440552.1_8 Reverse -119 -136 19.1505 0.0307
NP_441842.1_10 Forward -216 -202 6.88276 0.271
NP_440275.1_3 Reverse -238 -248 2.04498 0.273
NP_441307.1_6 Forward -202 -183 7.47261 0.217
NP_440679.1_10 Forward -394 -375 -18.2901 0.278
NP_441105.1_3 Forward -374 -355 -7.37537 0.251
NP_442373.1_2 Forward -399 -380 4.62101 0.148
NP_441226.1_7 Forward -177 -170 5.64364 0.286
NP_441766.1_9 Reverse -68 -87 7.47261 0.144
NP_440416.1_9 Reverse -380 -399 -12.0953 0.155
NP_443052.1_9 Reverse -380 -399 -1.7705 0.231
NP_441974.1_3 Forward -293 -276 16.3421 0.257
NP_442154.1_1 Forward -398 -380 1.39578 0.0916
NP_442154.1_1 Reverse -341 -359 -17.5821 0.26
NP_440261.1_5 Forward -84 -71 -11.0921 0.237
NP_440261.1_5 Reverse -63 -76 -11.3871 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCGGGTGTTGGCAGTGTTGGAACCGAGGTTGGCATCTGCCCCTCCAAAGCTCCCCTGCCAGAAGAAAAAGCCGACTACCAACAGGGGTAGGGACCAAAGTAGGGCAGTTCTCCAGGAAAATTTCATATGTTAGCTCACTTTAAAAGTTAAGACGGTCGTAGGATTTAGTGTAATCGGTTAACTGTGGAACGGAGACTGGACTCCGTCATGGAGGATTAGCTCCCCGACGCCGTGGAATTGATTAATTTTGTTGACAACGGAGTTTTGTAACAAAATCTTAACTAAATGTAACGTAATTCTCATAATTACGACAACCCCCTCGCCCCGGGAGGATCACCGCAAAATATTCACCATAACGAATTTGCTAGTTTGAAAGGTAATCGTTTAAGGGACACTGCC

CDS

ATGGGTCAAACCATCACTCCGCCTCCCCTCACCCTGGAGGAATTTTCCTGTTTACCGGAAGGGGAAGTTAACTACGAATTGCAAGACGGAACGGCGATCGCCAAAATGTCACCAAAAAGAATCCATTCCAGTCTCCAAAGAACGTTACTCTTTCTCCTGTCTGATTGGGGAAATAGCCAAGATTGTCCCTTGCCTGGCGAAGCCTATCCCGAATGGGGCATTTGTCTGCAAAAGGATGGGCAAGATTGGGCCCCGGTGCCTGATGTTACCTACATTTCTGACCAAAAATTGACTCCCTTCGCCCTGGAAAATGACTTTTGCCCTGTGGCCCCGGAATTGGTAGTGGAAATTATTTCCCCCGATCAATCCTTTGAAGCTATGACCCAAAAGGCTTTGGATTATCTGGCTGCCGGAGTAGAAAGGGTCTGGATTATTGGCGATCGCCATCGTAGTTTGACTATTTTTGCCCCCGACCGCCCGCCCCTTACCTATCAAGGAGACCAACTGGTGGAGGATGATTTATTGCCCCAGTTAAGCTTTACGGTTAATGAATTATTTGCTAAAGCTAAAGTCTAA

Protein

MGQTITPPPLTLEEFSCLPEGEVNYELQDGTAIAKMSPKRIHSSLQRTLLFLLSDWGNSQDCPLPGEAYPEWGICLQKDGQDWAPVPDVTYISDQKLTPFALENDFCPVAPELVVEIISPDQSFEAMTQKALDYLAAGVERVWIIGDRHRSLTIFAPDRPPLTYQGDQLVEDDLLPQLSFTVNELFAKAKV