Your browser is old and dusty. Try Google Chrome!

Details for sll0194

ORF sll0194
Accession NP_442162.1
Symbol ycf43
Category Protein and peptide secretion
Definition putative sec-independent protein translocase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -81 -95 4.71948 0.145
NP_440795.1_7 Forward -88 -81 14.6904 0.0123
NP_440795.1_7 Reverse -81 -88 14.6904 0.0123
NP_440795.1_7 Reverse -58 -65 10.8555 0.132
NP_440795.1_7 Reverse -99 -106 8.39725 0.213
NP_442100.1_1 Forward -328 -309 7.78217 0.245
NP_441418.1_1 Forward -357 -338 11.3154 0.203
NP_441418.1_6 Forward -89 -70 -20.7484 0.125
NP_442291.1_5 Reverse -79 -95 11.5633 0.0388
NP_442272.1_2 Reverse -207 -226 10.265 0.257
NP_442272.1_2 Reverse -266 -285 9.59652 0.289
NP_442272.1_7 Forward -359 -340 20.649 0.138
NP_441453.1_4 Reverse -80 -88 16.539 0.00633
NP_441453.1_4 Forward -89 -81 16.539 0.00633
NP_442151.1_6 Reverse -80 -94 16.9125 0.013
NP_442151.1_6 Forward -66 -52 9.5377 0.145
NP_441818.1_1 Reverse -81 -92 18.8393 0.00301
NP_440226.1_1 Forward -89 -70 14.5524 0.03
NP_440226.1_1 Reverse -80 -99 8.75091 0.0823
NP_441630.1_3 Forward -97 -78 -0.688862 0.288
NP_442173.1_1 Forward -88 -80 15.4574 0.00633
NP_442173.1_1 Reverse -81 -89 15.4574 0.00633
NP_442752.1_4 Forward -89 -82 13.8055 0.0199
NP_442752.1_4 Reverse -80 -87 13.8055 0.0199
NP_443027.1_4 Forward -91 -81 14.0414 0.0452
NP_443027.1_4 Reverse -55 -65 10.3048 0.134
NP_443027.1_4 Forward -73 -63 8.33817 0.207
NP_443027.1_4 Reverse -78 -88 7.25653 0.24
NP_442975.1_10 Forward -93 -79 13.1753 0.0459
NP_442975.1_10 Reverse -76 -90 2.06395 0.284
NP_441470.1_5 Reverse -266 -285 10.1721 0.262
NP_440784.1_7 Forward -88 -81 15.9687 0.0123
NP_440784.1_7 Reverse -81 -88 15.9687 0.0123
NP_440784.1_7 Forward -65 -58 9.67555 0.104
NP_442861.1_4 Forward -277 -258 1.57197 0.297
NP_441337.1_10 Forward -62 -43 16.8132 0.187
NP_441250.1_3 Reverse -179 -198 1.76941 0.284
NP_441054.1_4 Forward -99 -81 -1.35749 0.198
NP_439979.1_9 Forward -100 -82 11.3272 0.227
NP_442062.1_8 Reverse -80 -90 17.3846 0.00193
NP_442062.1_8 Forward -89 -79 10.3048 0.0493
NP_442972.1_1 Reverse -254 -272 13.0562 0.221
NP_440304.1_4 Forward -91 -81 10.8948 0.051
NP_440304.1_4 Reverse -78 -88 10.8948 0.051
NP_442242.1_4 Forward -88 -81 14.3954 0.0124
NP_442242.1_4 Reverse -81 -88 14.3954 0.0124
NP_440044.1_8 Forward -88 -69 5.30933 0.103
NP_440044.1_8 Forward -65 -46 -0.197208 0.214
NP_440044.1_8 Reverse -81 -100 -1.08219 0.235
NP_441200.1_4 Reverse -10 -29 6.29264 0.283
NP_441619.1_8 Reverse -74 -88 6.78381 0.295
NP_441208.1_9 Reverse -77 -91 7.47274 0.221
NP_441594.1_6 Forward -86 -67 1.37609 0.268
NP_440370.1_10 Reverse -48 -67 11.3075 0.187
NP_442110.1_7 Reverse -80 -94 9.14437 0.0755
NP_440856.1_4 Reverse -73 -92 -0.983855 0.189
NP_441083.1_5 Reverse -80 -90 20.3345 0.00053
NP_441083.1_5 Forward -89 -79 11.2881 0.0159
NP_441434.1_1 Reverse -212 -226 14.7174 0.233
NP_441738.1_2 Forward -87 -80 15.28 0.0102
NP_441738.1_2 Reverse -82 -89 15.28 0.0102
NP_440209.1_1 Reverse -80 -88 18.1123 0.00295
NP_440209.1_1 Forward -89 -81 18.1123 0.00295
NP_440870.1_4 Forward -72 -54 1.88744 0.217
NP_442889.1_8 Reverse -77 -91 7.76712 0.141
NP_442889.1_8 Forward -92 -78 3.63724 0.273
NP_441713.1_1 Reverse -74 -93 -15.2418 0.261
NP_441770.1_4 Reverse -99 -118 -11.8986 0.29
NP_440178.1_7 Reverse -79 -98 12.7825 0.00536
NP_441716.1_1 Reverse -80 -94 4.22782 0.256
NP_442111.1_4 Forward -90 -76 18.5841 0.00633
NP_442111.1_4 Reverse -56 -70 5.89945 0.145
NP_440906.1_5 Forward -88 -81 15.8704 0.0124
NP_440906.1_5 Reverse -81 -88 15.8704 0.0124
NP_440747.1_10 Reverse -77 -89 15.2803 0.0019
NP_440747.1_10 Forward -92 -80 7.51213 0.00286
NP_441486.1_1 Forward -92 -78 15.1426 0.0061
NP_441486.1_1 Reverse -77 -91 3.63784 0.0563
NP_442634.1_4 Forward -91 -77 -1.18038 0.149
NP_442634.1_4 Reverse -78 -92 -2.36035 0.149
NP_440842.1_10 Reverse -370 -384 3.8345 0.254
NP_442848.1_1 Forward -95 -81 -2.26202 0.263
NP_442848.1_4 Forward -160 -146 6.6861 0.283
NP_443018.1_3 Forward -88 -81 14.8871 0.0123
NP_443018.1_3 Reverse -81 -88 14.8871 0.0123
NP_443018.1_3 Reverse -58 -65 4.07068 0.299
NP_441316.1_7 Forward -91 -76 4.99478 0.121
NP_440376.1_1 Forward -89 -80 19.4693 0.000692
NP_440376.1_1 Reverse -80 -89 19.4693 0.000692
NP_440376.1_1 Reverse -106 -115 1.76968 0.242
NP_441002.1_5 Forward -165 -146 11.6025 0.221
NP_441588.1_4 Reverse -82 -92 8.63316 0.14
NP_441588.1_4 Forward -87 -77 7.05986 0.178
NP_442687.1_7 Reverse -79 -89 9.02648 0.0994
NP_442687.1_7 Forward -90 -80 8.92815 0.0994
NP_442687.1_7 Forward -108 -98 7.45319 0.132
NP_441077.1_2 Forward -196 -177 7.87766 0.182
NP_441077.1_6 Reverse -211 -227 18.3234 0.0733
NP_441077.1_6 Forward -191 -175 2.99468 0.272
NP_442485.1_3 Forward -118 -99 -1.27885 0.256
NP_441029.1_5 Reverse -199 -218 11.3286 0.273
NP_442658.1_1 Reverse -78 -88 13.0576 0.04
NP_442658.1_1 Forward -91 -81 6.76441 0.214
NP_442205.1_9 Forward -95 -79 -1.12144 0.264
NP_442544.1_6 Reverse -73 -92 2.3594 0.111
NP_441414.1_9 Reverse -80 -99 -0.885524 0.0949
NP_441414.1_9 Forward -382 -363 -10.7186 0.293
NP_441958.1_5 Reverse -79 -89 21.2195 0.000805
NP_441958.1_5 Forward -90 -80 12.2714 0.00183
NP_441127.1_1 Forward -382 -368 14.7492 0.134
NP_442836.1_5 Forward -95 -76 5.11266 0.193
NP_440203.1_5 Forward -86 -76 9.81266 0.245
NP_440269.1_2 Reverse -199 -213 15.0442 0.281
NP_442816.1_7 Forward -273 -254 6.73176 0.24
NP_442816.1_7 Reverse -233 -252 5.58586 0.244
NP_439905.1_5 Forward -246 -232 12.8809 0.288
NP_440984.1_7 Forward -94 -80 7.57108 0.166
NP_442911.1_2 Reverse -70 -89 -1.08219 0.0811
NP_442911.1_2 Forward -99 -80 -3.44213 0.112
NP_441580.1_6 Forward -100 -81 -6.29373 0.235
NP_440153.1_5 Reverse -81 -95 8.65272 0.136
NP_443055.1_6 Forward -115 -97 2.47668 0.209
NP_440993.1_2 Reverse -75 -91 1.14018 0.29
NP_440602.1_2 Forward -94 -75 0.294447 0.296
NP_440602.1_8 Reverse -80 -94 17.5025 0.0898
NP_441099.1_5 Forward -99 -80 -0.983855 0.101
NP_442002.1_9 Forward -151 -144 11.3472 0.185
NP_441294.1_7 Reverse -76 -90 11.9383 0.12
NP_441294.1_7 Forward -93 -79 10.7864 0.171
NP_441646.1_1 Reverse -73 -92 0.491109 0.251
NP_442438.1_10 Forward -94 -80 7.86607 0.0859
NP_441000.1_6 Reverse -79 -93 -4.62196 0.248
NP_440147.1_4 Reverse -78 -91 12.9006 0.0326
NP_440147.1_4 Forward -91 -78 1.59258 0.224
NP_441550.1_8 Reverse -78 -88 15.3192 0.0132
NP_441550.1_8 Forward -91 -81 12.3692 0.0336
NP_441550.1_8 Forward -68 -58 6.86274 0.188
NP_441916.1_7 Forward -89 -79 18.9579 0.00144
NP_441916.1_7 Reverse -80 -90 10.3048 0.0261
NP_441916.1_10 Forward -97 -78 10.4225 0.148
NP_441041.1_4 Reverse -80 -99 -3.24547 0.12
NP_441041.1_4 Reverse -51 -70 -10.9153 0.238
NP_441041.1_4 Forward -89 -70 -11.8003 0.252
NP_441041.1_7 Reverse -77 -89 14.4144 0.0348
NP_442004.1_6 Forward -89 -75 3.34284 0.242
NP_441725.1_4 Reverse -75 -89 3.14559 0.279
NP_441725.1_5 Reverse -81 -91 11.2881 0.0247
NP_441725.1_5 Forward -88 -78 1.94665 0.115
NP_439966.1_7 Forward -91 -81 15.8108 0.0124
NP_439966.1_7 Reverse -371 -381 6.66608 0.173
NP_439966.1_7 Reverse -78 -88 6.27276 0.185
NP_440736.1_3 Forward -91 -72 -0.983855 0.282
NP_442941.1_3 Reverse -81 -91 19.9412 0.00262
NP_442941.1_3 Forward -88 -78 11.0914 0.0116
NP_440289.1_2 Forward -92 -79 6.50913 0.0591
NP_440289.1_2 Reverse -77 -90 -4.89726 0.294
NP_441514.1_6 Reverse -7 -14 12.7238 0.29
NP_442281.1_1 Forward -94 -80 17.2068 0.00633
NP_442281.1_1 Reverse -75 -89 10.3237 0.0595
NP_442281.1_1 Forward -76 -62 1.86729 0.285
NP_441079.1_7 Reverse -228 -247 2.85027 0.173
NP_440437.1_1 Forward -72 -53 -1.57384 0.205
NP_440647.1_9 Forward -117 -99 3.16574 0.281
NP_441457.1_7 Reverse -78 -97 2.75272 0.255
NP_442288.1_4 Reverse -212 -226 17.8686 0.199
NP_440498.1_1 Reverse -71 -89 3.85406 0.138
NP_440498.1_1 Forward -98 -80 -1.06249 0.222
NP_441644.1_6 Forward -89 -79 19.0557 0.000803
NP_441644.1_6 Reverse -80 -90 17.3841 0.00127
NP_442215.1_2 Reverse -78 -94 6.54838 0.0702
NP_442215.1_2 Forward -91 -75 -3.97304 0.225
NP_440253.1_2 Reverse -98 -116 -1.55415 0.244
NP_440253.1_2 Reverse -80 -98 -1.55415 0.244
NP_440929.1_8 Forward -89 -80 19.2726 0.000701
NP_440929.1_8 Reverse -80 -89 19.2726 0.000701
NP_442933.1_1 Forward -285 -266 22.5834 0.0325
NP_442933.1_1 Reverse -339 -358 11.7928 0.242
NP_442933.1_1 Forward -292 -273 8.16414 0.253
NP_442933.1_1 Forward -280 -261 7.78217 0.253
NP_442933.1_2 Reverse -269 -287 14.8987 0.227
NP_442933.1_2 Forward -251 -233 9.74216 0.257
NP_442933.1_2 Forward -359 -341 9.2647 0.257
NP_442933.1_6 Forward -227 -208 12.2703 0.288
NP_442933.1_10 Forward -89 -80 17.601 0.00325
NP_442933.1_10 Reverse -80 -89 17.601 0.00325
NP_442671.1_2 Reverse -254 -273 -0.379662 0.294
NP_440382.1_2 Reverse -211 -230 3.53858 0.274
NP_441751.2_8 Forward -88 -74 8.65272 0.0325
NP_441751.2_8 Reverse -81 -95 6.58777 0.0348
NP_442554.1_8 Forward -88 -78 16.4013 0.0065
NP_442554.1_8 Reverse -81 -91 15.9097 0.00747
NP_442554.1_8 Reverse -63 -73 5.68323 0.141
NP_442554.1_8 Forward -70 -60 3.81494 0.209
NP_442554.1_8 Reverse -58 -68 3.12662 0.239
NP_442554.1_8 Forward -65 -55 1.94665 0.288
NP_442970.1_3 Forward -272 -254 15.9721 0.156
NP_442970.1_3 Forward -201 -183 12.0191 0.251
NP_441762.1_7 Forward -90 -78 0.333971 0.0747
NP_441762.1_7 Reverse -79 -91 -6.74586 0.284
NP_442142.1_4 Forward -92 -79 14.7683 0.0302
NP_442142.1_4 Reverse -77 -90 11.6217 0.054
NP_442292.1_1 Reverse -81 -90 18.486 0.00229
NP_442292.1_1 Forward -88 -79 17.5026 0.00435
NP_442292.1_1 Forward -65 -56 5.50626 0.143
NP_442476.1_6 Forward -88 -74 0.196253 0.269
NP_442381.1_8 Reverse -95 -114 -14.2585 0.28
NP_443009.1_5 Forward -90 -79 14.5128 0.02
NP_443009.1_5 Reverse -79 -90 10.1862 0.0792
NP_441715.1_4 Reverse -81 -91 14.828 0.0268
NP_441715.1_4 Forward -88 -78 7.35486 0.108
NP_441198.1_8 Reverse -78 -88 12.783 0.116
NP_441468.1_1 Forward -88 -81 15.8704 0.0124
NP_441468.1_1 Reverse -81 -88 15.8704 0.0124
NP_441468.1_1 Reverse -58 -65 4.07068 0.263
NP_441020.2_6 Forward -91 -74 5.64371 0.293
NP_441015.1_10 Forward -100 -81 -5.70374 0.23
NP_441673.1_1 Forward -89 -80 20.8459 0.000698
NP_441673.1_1 Reverse -80 -89 20.8459 0.000698
NP_441826.1_2 Forward -95 -81 15.7325 0.0196
NP_441764.1_4 Reverse -205 -222 9.69521 0.281
NP_441764.1_8 Reverse -280 -290 12.0764 0.284
NP_442868.1_6 Forward -91 -81 9.91146 0.038
NP_442868.1_6 Reverse -78 -88 0.963343 0.205
NP_442719.1_2 Reverse -107 -125 -10.0113 0.268
NP_441056.1_1 Reverse -80 -99 9.83255 0.0639
NP_441612.1_2 Reverse -80 -90 8.54929 0.21
NP_441911.1_10 Reverse -197 -216 11.4512 0.21
NP_441911.1_10 Reverse -268 -287 10.0051 0.226
NP_441911.1_10 Reverse -266 -285 9.42666 0.231
NP_441911.1_10 Forward -253 -234 7.69133 0.274
NP_442808.1_1 Reverse -79 -89 8.73102 0.0481
NP_442808.1_1 Forward -90 -80 8.63269 0.0481
NP_442808.1_1 Forward -108 -98 5.09279 0.173
NP_441849.1_7 Reverse -259 -272 16.9638 0.218
NP_440145.1_3 Reverse -70 -89 1.17943 0.129
NP_442050.1_5 Forward -91 -81 16.4991 0.00812
NP_442050.1_5 Reverse -78 -88 9.22267 0.193
NP_442050.1_6 Forward -127 -108 15.7324 0.203
NP_440558.1_2 Reverse -71 -90 0.982764 0.185
NP_441518.1_3 Forward -99 -80 -12.6852 0.263
NP_441878.1_6 Reverse -79 -89 10.5014 0.0176
NP_441878.1_6 Forward -90 -80 10.4031 0.0176
NP_441036.1_8 Reverse -79 -89 15.713 0.00724
NP_441036.1_8 Forward -90 -80 8.33817 0.174
NP_441557.1_5 Forward -89 -80 19.9609 0.000699
NP_441557.1_5 Reverse -80 -89 19.9609 0.000699
NP_441445.1_1 Reverse -71 -90 1.96607 0.245
NP_440084.1_8 Forward -227 -213 9.27434 0.29
NP_440084.1_8 Reverse -222 -236 8.70139 0.299
NP_441739.1_2 Reverse -141 -157 2.61447 0.288
NP_440101.1_3 Reverse -46 -65 3.34271 0.234
NP_441458.1_8 Forward -229 -210 4.0221 0.267
NP_441458.1_8 Reverse -300 -319 3.34933 0.273
NP_441564.1_10 Forward -103 -84 1.57275 0.287
NP_442183.1_1 Reverse -80 -94 7.37441 0.143
NP_442183.1_1 Forward -382 -368 7.07942 0.149
NP_441549.1_9 Forward -93 -75 -5.09406 0.198
NP_442347.1_2 Reverse -81 -90 12.4878 0.056
NP_442347.1_2 Forward -88 -79 3.34298 0.284
NP_442645.1_2 Forward -97 -78 2.45773 0.0376
NP_442645.1_2 Reverse -72 -91 -22.3217 0.29
NP_441037.1_4 Reverse -78 -88 15.0168 0.028
NP_441633.1_3 Forward -91 -78 -6.07724 0.236
NP_441633.1_3 Reverse -78 -91 -6.07724 0.236
NP_440136.1_2 Forward -88 -81 15.9687 0.0123
NP_440136.1_2 Reverse -81 -88 15.9687 0.0123
NP_442590.1_10 Reverse -80 -99 5.11266 0.267
NP_441728.2_4 Reverse -204 -223 15.135 0.216
NP_442998.1_10 Forward -87 -80 15.5754 0.0102
NP_442998.1_10 Reverse -82 -89 15.5754 0.0102
NP_440299.1_1 Reverse -76 -89 9.45847 0.0709
NP_440299.1_1 Forward -93 -80 4.44361 0.207
NP_441799.1_1 Reverse -76 -90 17.8952 0.00999
NP_441799.1_1 Forward -93 -79 11.012 0.0629
NP_441007.1_10 Reverse -75 -88 1.10092 0.209
NP_441007.1_10 Forward -94 -81 0.805932 0.216
NP_440256.1_1 Forward -92 -73 2.45773 0.0634
NP_440256.1_1 Reverse -77 -96 0.196116 0.0858
NP_441559.1_8 Reverse -75 -89 -1.08205 0.18
NP_440915.1_6 Forward -93 -79 4.03116 0.1
NP_440915.1_6 Reverse -76 -90 0.982901 0.148
NP_441179.1_9 Forward -109 -99 12.6642 0.272
NP_440748.1_5 Forward -104 -85 -0.885524 0.263
NP_440695.1_6 Forward -125 -111 14.7744 0.208
NP_440188.1_4 Forward -100 -81 6.78429 0.276
NP_441199.1_7 Forward -360 -341 2.65439 0.253
NP_442993.1_1 Reverse -80 -96 2.12349 0.0502
NP_440677.1_6 Reverse -77 -96 7.17762 0.298
NP_442386.1_9 Forward -90 -81 13.8639 0.0289
NP_442386.1_9 Reverse -79 -88 6.39082 0.219
NP_441340.1_5 Forward -88 -81 15.6737 0.0124
NP_441340.1_5 Reverse -81 -88 15.6737 0.0124
NP_442327.1_3 Forward -194 -175 12.9387 0.182
NP_440586.1_8 Forward -88 -81 13.2151 0.026
NP_440586.1_8 Reverse -81 -88 13.2151 0.026
NP_440586.1_8 Reverse -58 -65 7.41359 0.251
NP_442251.1_6 Forward -88 -81 15.2804 0.0124
NP_442251.1_6 Reverse -81 -88 15.2804 0.0124
NP_440684.1_9 Forward -95 -81 9.34103 0.221
NP_441262.1_3 Reverse -80 -87 14.7888 0.0223
NP_441262.1_3 Forward -89 -82 14.7888 0.0223
NP_443051.1_1 Reverse -79 -88 19.5676 0.00335
NP_443051.1_1 Forward -90 -81 10.4228 0.00754
NP_441232.1_10 Reverse -69 -88 8.94757 0.139
NP_439937.1_9 Forward -108 -91 -11.5649 0.257
NP_439937.1_9 Forward -90 -73 -14.9081 0.287
NP_441595.1_2 Forward -174 -161 9.89744 0.277
NP_441595.1_2 Forward -269 -256 9.61097 0.277
NP_440439.1_1 Reverse -77 -90 2.08423 0.138
NP_440439.1_1 Forward -92 -79 -0.177378 0.209
NP_439943.1_7 Reverse -81 -100 2.75272 0.292
NP_440372.1_2 Forward -88 -81 16.3621 0.0124
NP_440372.1_2 Reverse -81 -88 16.3621 0.0124
NP_441138.1_5 Forward -279 -266 7.79662 0.257
NP_441138.1_5 Forward -213 -200 3.78596 0.297
NP_441293.1_3 Reverse -253 -271 12.1295 0.291
NP_441572.1_7 Forward -95 -76 5.50599 0.0867
NP_440267.1_2 Reverse -75 -89 10.9137 0.125
NP_440267.1_2 Forward -94 -80 8.45543 0.162
NP_442384.1_10 Forward -89 -76 14.4739 0.0148
NP_442384.1_10 Reverse -80 -93 1.10092 0.268
NP_442114.1_2 Reverse -300 -319 3.14605 0.262
NP_442114.1_8 Reverse -268 -282 11.2087 0.234
NP_442114.1_8 Reverse -264 -278 11.012 0.234
NP_442114.1_8 Forward -248 -234 4.22722 0.271
NP_442790.1_4 Reverse -51 -70 -15.2418 0.289
NP_442262.1_10 Forward -88 -81 14.1988 0.0123
NP_442262.1_10 Reverse -81 -88 14.1988 0.0123
NP_441689.1_5 Forward -91 -81 15.3192 0.0403
NP_441689.1_5 Reverse -78 -88 8.3377 0.132
NP_440163.1_10 Forward -92 -82 11.3864 0.169
NP_440344.1_10 Reverse -73 -90 -0.0594896 0.0381
NP_440075.1_2 Reverse -94 -113 9.83255 0.188
NP_442910.1_1 Reverse -73 -92 -4.32711 0.254
NP_441965.1_10 Forward -92 -76 8.71166 0.123
NP_440297.1_9 Reverse -81 -91 9.32148 0.0917
NP_440297.1_9 Forward -65 -55 0.0783647 0.282
NP_440297.1_9 Reverse -63 -73 -0.118297 0.282
NP_440297.1_9 Forward -88 -78 -0.216628 0.282
NP_440350.1_5 Forward -218 -199 1.17943 0.158
NP_440350.1_5 Forward -285 -266 -0.295539 0.176
NP_440350.1_5 Reverse -232 -251 -3.14714 0.255
NP_442280.1_10 Forward -21 -3 6.03883 0.28
NP_440888.1_2 Reverse -80 -94 18.0918 0.00261
NP_440888.1_2 Forward -89 -75 5.40719 0.28
NP_442557.1_2 Forward -98 -80 15.2604 0.156
NP_440792.1_5 Forward -88 -69 7.66927 0.237
NP_442277.1_7 Reverse -264 -280 -0.279674 0.221
NP_442277.1_7 Forward -252 -236 -1.52107 0.278
NP_441543.1_2 Reverse -81 -90 16.9127 0.00359
NP_441543.1_2 Forward -88 -79 15.9293 0.00518
NP_442845.1_2 Forward -95 -81 14.4542 0.0801
NP_442845.1_2 Reverse -74 -88 11.0127 0.138
NP_441304.1_10 Forward -31 -22 13.1761 0.255
NP_442710.1_7 Reverse -266 -285 -6.45386 0.294
NP_441469.1_8 Reverse -79 -88 6.5879 0.227
NP_441469.1_8 Forward -90 -81 6.48957 0.227
NP_441469.1_8 Forward -72 -63 5.21127 0.283
NP_443064.1_6 Reverse -80 -90 12.5669 0.0796
NP_443064.1_6 Forward -89 -79 10.8217 0.13
NP_442578.1_7 Forward -88 -81 14.5921 0.026
NP_442578.1_7 Reverse -81 -88 14.5921 0.026
NP_440148.1_1 Forward -189 -170 -5.9004 0.24
NP_441462.1_2 Forward -89 -79 20.2362 0.000805
NP_441462.1_2 Reverse -80 -90 11.5831 0.00406
NP_441621.1_7 Forward -91 -77 -5.11362 0.248
NP_443062.1_1 Reverse -80 -98 18.1991 0.0227
NP_443062.1_1 Forward -89 -71 10.8861 0.108
NP_440936.1_10 Forward -285 -266 2.62561 0.206
NP_442204.1_1 Reverse -76 -87 8.51513 0.0919
NP_441560.1_10 Reverse -72 -91 7.07928 0.287
NP_440516.1_8 Forward -89 -80 16.9127 0.00442
NP_440516.1_8 Reverse -80 -89 16.9127 0.00442
NP_442428.1_5 Forward -88 -81 15.8704 0.0124
NP_442428.1_5 Reverse -81 -88 15.8704 0.0124
NP_442428.1_5 Reverse -58 -65 4.56234 0.249
NP_442120.1_10 Reverse -80 -99 1.86774 0.156
NP_440673.1_2 Reverse -47 -66 9.99938 0.226
NP_440673.1_3 Forward -87 -80 12.4288 0.0426
NP_440673.1_3 Reverse -82 -89 12.4288 0.0426
NP_440673.1_3 Reverse -53 -60 8.20058 0.234
NP_440673.1_7 Forward -100 -81 4.12936 0.189
NP_441052.1_2 Reverse -80 -90 19.9412 0.00106
NP_441052.1_2 Forward -89 -79 10.4031 0.0285
NP_442219.1_9 Reverse -81 -90 17.7976 0.00718
NP_442219.1_9 Forward -88 -79 8.25953 0.0681
NP_440436.1_4 Reverse -81 -90 17.2072 0.00233
NP_440436.1_4 Forward -88 -79 9.24241 0.0871
NP_440314.1_9 Forward -88 -69 -5.40875 0.223
NP_440314.1_9 Reverse -81 -100 -8.26035 0.246
NP_441719.1_4 Forward -88 -81 16.3621 0.0124
NP_441719.1_4 Reverse -81 -88 16.3621 0.0124
NP_441231.1_3 Reverse -143 -162 12.88 0.259
NP_442366.1_3 Reverse -79 -97 1.19912 0.156
NP_442366.1_5 Reverse -77 -87 14.0409 0.0497
NP_442206.1_10 Forward -89 -74 5.09311 0.178
NP_440328.1_4 Forward -95 -76 7.07928 0.124
NP_443054.1_2 Forward -91 -77 1.47456 0.245
NP_441851.1_10 Forward -90 -80 15.8113 0.00552
NP_441851.1_10 Reverse -79 -89 8.53483 0.114
NP_442939.1_3 Forward -189 -175 16.4362 0.257
NP_441668.1_9 Reverse -239 -258 16.6165 0.2
NP_442515.1_1 Reverse -79 -93 0.786239 0.18
NP_441982.1_6 Reverse -147 -156 11.1485 0.288
NP_440338.1_4 Reverse -175 -194 6.88182 0.285
NP_442689.1_8 Reverse -107 -124 -4.68105 0.267
NP_441349.1_10 Reverse -70 -89 1.47442 0.0833
NP_441349.1_10 Forward -99 -80 -0.4922 0.0947
NP_441409.1_6 Reverse -74 -93 2.0644 0.0584
NP_441409.1_8 Reverse -268 -287 9.52306 0.237
NP_440432.1_9 Reverse -81 -96 -1.5934 0.167
NP_440474.1_8 Reverse -81 -95 7.86545 0.196
NP_441150.1_6 Reverse -83 -102 13.0766 0.277
NP_441124.1_5 Reverse -112 -122 10.1434 0.297
NP_440431.1_4 Reverse -270 -289 11.8883 0.0454
NP_440431.1_4 Reverse -275 -294 1.38421 0.156
NP_440431.1_4 Reverse -271 -290 0.90675 0.16
NP_440431.1_4 Reverse -266 -285 -8.92892 0.275
NP_442450.1_5 Forward -91 -81 9.32148 0.115
NP_442450.1_5 Reverse -78 -88 7.64985 0.13
NP_442168.1_5 Forward -88 -69 5.89931 0.198
NP_440588.1_2 Reverse -71 -90 -2.36049 0.164
NP_443047.1_7 Reverse -81 -100 7.27595 0.22
NP_441570.1_1 Reverse -80 -98 -0.177514 0.0437
NP_441570.1_1 Forward -66 -48 -10.7973 0.18
NP_441570.1_1 Forward -89 -71 -16.5988 0.249
NP_441078.1_4 Forward -89 -80 19.6659 0.0007
NP_441078.1_4 Reverse -80 -89 19.6659 0.0007
NP_440526.1_3 Reverse -81 -92 10.1862 0.0646
NP_441432.1_8 Reverse -79 -88 16.8143 0.00595
NP_441432.1_8 Forward -90 -81 16.8143 0.00595
NP_441432.1_9 Reverse -233 -246 13.2523 0.182
NP_441432.1_9 Forward -287 -274 10.9253 0.235
NP_441432.1_9 Forward -283 -270 10.2466 0.254
NP_441333.1_1 Forward -163 -153 12.3526 0.237
NP_442320.1_8 Forward -95 -81 11.996 0.0175
NP_441732.1_2 Reverse -76 -92 1.63183 0.0341
NP_441030.1_4 Reverse -258 -277 5.68135 0.277
NP_440760.1_1 Reverse -80 -99 -11.7019 0.0878
NP_440199.1_10 Forward -92 -82 16.7946 0.0381
NP_442400.1_10 Reverse -254 -267 8.0831 0.279
NP_442400.1_10 Reverse -142 -155 7.89211 0.281
NP_442489.1_7 Forward -89 -80 20.1576 0.000695
NP_442489.1_7 Reverse -80 -89 20.1576 0.000695
NP_442079.1_7 Forward -88 -69 2.26107 0.232
NP_440559.1_1 Reverse -81 -90 17.4043 0.00658
NP_440559.1_1 Forward -88 -79 8.65285 0.0586
NP_441659.2_8 Forward -89 -79 20.9245 0.000805
NP_441659.2_8 Reverse -80 -90 18.1713 0.00133
NP_440786.1_9 Forward -248 -229 16.3224 0.18
NP_442913.1_10 Forward -98 -79 9.53756 0.0449
NP_442346.1_5 Forward -90 -80 16.6963 0.00248
NP_442346.1_5 Reverse -79 -89 16.303 0.00248
NP_440545.1_3 Reverse -76 -93 -2.81276 0.193
NP_440545.1_3 Reverse -58 -75 -3.30441 0.203
NP_440545.1_3 Forward -93 -76 -4.58271 0.229
NP_441856.1_3 Forward -92 -73 -1.27885 0.236
NP_440459.1_2 Forward -98 -81 10.7569 0.192
NP_441653.1_2 Forward -100 -81 2.75655 0.288
NP_441833.1_4 Forward -88 -81 15.9687 0.0124
NP_441833.1_4 Reverse -81 -88 15.9687 0.0124
NP_441329.1_6 Reverse -195 -214 8.06865 0.156
NP_441329.1_6 Reverse -267 -286 3.00757 0.217
NP_441329.1_6 Forward -361 -342 2.14815 0.231
NP_441329.1_6 Reverse -271 -290 -0.621121 0.278
NP_441329.1_6 Forward -365 -346 -2.62645 0.294
NP_442162.1_6 Forward -62 -43 21.8289 0.0259
NP_442162.1_9 Forward -88 -81 16.2637 0.0124
NP_442162.1_9 Reverse -81 -88 16.2637 0.0124
NP_440671.1_4 Forward -95 -81 15.6342 0.0405
NP_440671.1_4 Reverse -74 -88 6.78443 0.235
NP_441044.1_4 Reverse -17 -35 6.50899 0.223
NP_442140.1_3 Forward -88 -78 6.66654 0.159
NP_442140.1_3 Reverse -81 -91 4.40493 0.243
NP_440875.1_9 Forward -87 -77 8.37203 0.233
NP_441813.1_5 Forward -91 -81 15.9097 0.01
NP_441813.1_5 Reverse -78 -88 8.63316 0.0367
NP_442028.1_1 Forward -283 -270 10.1839 0.251
NP_442028.1_1 Forward -224 -211 9.32449 0.251
NP_442028.1_1 Forward -165 -152 7.60564 0.292
NP_440590.1_4 Reverse -81 -94 2.57589 0.0845
NP_440567.1_1 Forward -88 -74 15.8309 0.0166
NP_440567.1_1 Reverse -81 -95 5.30946 0.104
NP_442497.1_10 Forward -88 -79 17.601 0.00813
NP_442497.1_10 Reverse -81 -90 10.4228 0.0087
NP_440821.1_4 Forward -91 -81 18.2696 0.00448
NP_440821.1_4 Reverse -78 -88 2.24165 0.131
NP_441239.1_9 Reverse -78 -90 11.1504 0.0648
NP_441239.1_9 Reverse -60 -72 9.28209 0.11
NP_441239.1_9 Forward -91 -79 4.36554 0.253
NP_441239.1_9 Reverse -371 -383 3.48056 0.285
NP_441009.1_4 Forward -89 -70 12.8808 0.219
NP_441727.1_3 Reverse -73 -92 4.03102 0.275
NP_440219.1_1 Forward -273 -254 14.1783 0.216
NP_440546.1_4 Forward -89 -79 13.5365 0.0459
NP_440546.1_4 Reverse -80 -90 10.046 0.109
NP_440462.1_6 Reverse -78 -88 10.5014 0.0396
NP_440462.1_6 Forward -91 -81 7.74818 0.0699
NP_442465.1_9 Reverse -203 -217 11.5043 0.253
NP_442611.1_1 Forward -141 -122 0.786102 0.253
NP_440868.1_4 Reverse -76 -88 13.2153 0.022
NP_440868.1_4 Forward -93 -81 5.93884 0.0879
NP_441497.1_2 Forward -219 -200 5.89931 0.233
NP_442479.1_9 Reverse -105 -124 -8.55534 0.266
NP_441848.1_4 Reverse -204 -220 7.74165 0.288
NP_441848.1_7 Forward -221 -202 -3.54122 0.284
NP_442039.1_4 Forward -88 -81 15.1821 0.0124
NP_442039.1_4 Reverse -81 -88 15.1821 0.0124
NP_442039.1_4 Forward -381 -374 8.69224 0.172
NP_442679.1_1 Reverse -271 -290 -0.983855 0.226
NP_442679.1_1 Forward -253 -234 -2.55715 0.24
NP_442380.1_10 Forward -105 -87 7.19731 0.294
NP_441926.1_3 Reverse -80 -96 15.3982 0.0428
NP_442837.1_3 Forward -88 -81 15.7721 0.0124
NP_442837.1_3 Reverse -81 -88 15.7721 0.0124
NP_440160.1_1 Forward -361 -342 10.9163 0.232
NP_440160.1_1 Reverse -203 -222 9.385 0.266
NP_442053.1_1 Forward -89 -80 18.3876 0.0007
NP_442053.1_1 Reverse -80 -89 18.3876 0.0007
NP_440505.1_3 Forward -91 -81 16.303 0.00696
NP_440505.1_3 Reverse -78 -88 8.04317 0.147
NP_441959.1_8 Reverse -256 -269 19.6032 0.123
NP_441959.1_8 Reverse -183 -196 8.32366 0.296
NP_441252.1_6 Forward -153 -146 14.3954 0.168
NP_442532.1_1 Reverse -270 -284 9.14183 0.284
NP_442532.1_2 Reverse -269 -288 0.0473228 0.295
NP_441408.2_7 Reverse -279 -298 -5.11376 0.291
NP_440914.1_1 Reverse -80 -90 17.5935 0.000537
NP_440914.1_1 Forward -89 -79 16.3248 0.00196
NP_440914.1_1 Forward -115 -105 9.39583 0.186
NP_441011.1_8 Forward -88 -79 16.6177 0.00602
NP_441011.1_8 Reverse -81 -90 8.25953 0.144
NP_442101.1_6 Forward -163 -144 13.3725 0.21
NP_442101.1_10 Reverse -72 -91 -7.27704 0.21
NP_442533.1_6 Forward -89 -80 17.2076 0.00137
NP_442533.1_6 Reverse -80 -89 17.2076 0.00137
NP_439981.1_1 Forward -43 -24 20.4523 0.0739
NP_440854.1_7 Reverse -232 -246 15.2889 0.246
NP_441482.1_7 Reverse -74 -88 -3.147 0.11
NP_439944.1_9 Reverse -81 -91 19.0562 0.00329
NP_439944.1_9 Forward -88 -78 9.12481 0.1
NP_441697.1_5 Reverse -228 -247 -6.25514 0.232
NP_441697.1_5 Reverse -212 -231 -7.30556 0.242
NP_441697.1_5 Forward -229 -210 -7.974 0.252
NP_441697.1_5 Reverse -296 -315 -8.73794 0.268
NP_441697.1_5 Reverse -300 -319 -11.0297 0.29
NP_440116.1_5 Forward -92 -75 5.15205 0.176
NP_440116.1_8 Forward -88 -69 -3.3438 0.151
NP_440116.1_8 Reverse -81 -100 -6.29373 0.205
NP_441527.1_4 Reverse -272 -291 14.9441 0.0458
NP_441527.1_4 Reverse -271 -290 7.97315 0.0885
NP_441527.1_4 Reverse -265 -284 7.20922 0.0947
NP_441527.1_4 Reverse -268 -287 4.72643 0.111
NP_441527.1_4 Reverse -199 -218 4.34446 0.111
NP_441527.1_4 Reverse -266 -285 3.867 0.111
NP_441527.1_4 Reverse -273 -292 -1.19407 0.146
NP_441527.1_4 Reverse -270 -289 -2.0535 0.153
NP_441527.1_4 Reverse -267 -286 -4.53629 0.187
NP_441527.1_4 Reverse -274 -293 -5.10924 0.195
NP_441527.1_4 Reverse -198 -217 -6.25514 0.215
NP_441527.1_4 Reverse -275 -294 -6.54162 0.221
NP_441527.1_4 Forward -248 -229 -7.21006 0.231
NP_441527.1_4 Reverse -282 -301 -10.4568 0.27
NP_441527.1_4 Reverse -197 -216 -11.2207 0.278
NP_441527.1_4 Reverse -196 -215 -11.5072 0.282
NP_441527.1_4 Reverse -202 -221 -11.8892 0.284
NP_441527.1_4 Reverse -276 -295 -12.1756 0.285
NP_441527.1_4 Forward -243 -224 -12.3666 0.285
NP_441527.1_4 Reverse -269 -288 -12.8441 0.294
NP_441527.1_4 Forward -330 -311 -12.9396 0.296
NP_440115.1_6 Reverse -77 -87 7.35486 0.147
NP_440007.1_9 Forward -93 -79 1.47456 0.285
NP_441347.1_5 Reverse -74 -88 9.43874 0.269
NP_440608.1_1 Reverse -261 -280 9.51364 0.219
NP_441602.1_3 Reverse -81 -100 -4.72043 0.272
NP_441106.1_1 Reverse -79 -88 18.486 0.0028
NP_441106.1_1 Forward -90 -81 9.63616 0.0311
NP_439903.1_6 Forward -26 -7 0.981987 0.255
NP_441286.1_1 Reverse -79 -91 11.937 0.0108
NP_441286.1_1 Forward -90 -78 5.93884 0.0258
NP_440670.1_8 Forward -89 -80 18.3876 0.000699
NP_440670.1_8 Reverse -80 -89 18.3876 0.000699
NP_440670.1_8 Forward -382 -373 3.24465 0.29
NP_442908.1_1 Forward -271 -252 1.0811 0.277
NP_441930.1_3 Forward -250 -231 7.28984 0.263
NP_440103.1_3 Reverse -314 -324 16.739 0.286
NP_440886.1_7 Reverse -79 -89 8.04271 0.0805
NP_440886.1_7 Forward -90 -80 7.94438 0.0805
NP_440886.1_7 Reverse -97 -107 5.58445 0.175
NP_442614.1_2 Reverse -80 -94 5.80112 0.297
NP_439995.1_5 Reverse -363 -382 12.6841 0.166
NP_440404.1_9 Reverse -273 -292 10.7424 0.209
NP_440404.1_9 Forward -354 -335 10.6469 0.209
NP_442072.1_9 Reverse -79 -97 -11.1906 0.0789
NP_442072.1_9 Forward -97 -79 -23.0886 0.277
NP_442125.1_2 Forward -365 -346 20.059 0.00251
NP_440907.2_8 Forward -88 -78 15.9091 0.0161
NP_441021.1_1 Reverse -81 -100 -5.31042 0.177
NP_442459.1_7 Forward -222 -203 -0.000545616 0.272
NP_441463.1_2 Forward -274 -256 1.42786 0.256
NP_441463.1_3 Reverse -70 -89 -3.44213 0.176
NP_441463.1_3 Forward -99 -80 -9.24366 0.278
NP_442842.1_10 Forward -216 -197 8.42576 0.207
NP_442842.1_10 Forward -286 -267 6.38714 0.207
NP_442842.1_10 Forward -293 -274 2.69821 0.254
NP_442842.1_10 Forward -282 -263 -0.408261 0.285
NP_441626.1_2 Forward -88 -81 15.7721 0.0124
NP_441626.1_2 Reverse -81 -88 15.7721 0.0124
NP_442794.1_1 Reverse -76 -88 2.79224 0.286
NP_441401.1_4 Reverse -270 -283 18.2105 0.131
NP_442615.1_1 Reverse -71 -89 2.87075 0.0614
NP_442467.1_4 Reverse -80 -99 9.3409 0.194
NP_440387.1_1 Forward -89 -73 7.33503 0.0282
NP_440387.1_1 Reverse -80 -96 -2.10475 0.146
NP_441993.1_1 Reverse -80 -99 9.64582 0.135
NP_441993.1_1 Forward -95 -76 8.86616 0.136
NP_440467.1_3 Forward -88 -69 11.9399 0.261
NP_440114.1_10 Reverse -80 -94 10.4227 0.148
NP_440114.1_10 Forward -89 -75 8.16106 0.213
NP_440492.1_9 Reverse -208 -222 9.69621 0.294
NP_440754.1_10 Reverse -276 -290 16.9125 0.152
NP_441510.2_7 Forward -95 -81 10.2254 0.281
NP_441421.1_9 Reverse -255 -274 3.53937 0.226
NP_439988.1_3 Forward -385 -371 6.29277 0.278
NP_439910.1_2 Forward -97 -80 -12.0559 0.0788
NP_440457.1_1 Reverse -76 -88 2.20226 0.216
NP_440457.1_1 Forward -93 -81 0.0389777 0.25
NP_440798.1_6 Forward -88 -75 10.1474 0.0808
NP_442680.1_5 Reverse -204 -223 0.951443 0.255
NP_441889.1_4 Forward -98 -79 0.0977854 0.296
NP_442509.1_9 Reverse -80 -90 8.14104 0.192
NP_442509.1_9 Forward -89 -79 8.04271 0.192
NP_441253.1_1 Forward -98 -79 5.40766 0.264
NP_441253.1_8 Reverse -75 -89 10.4745 0.282
NP_441159.1_8 Forward -274 -255 1.08032 0.236
NP_440554.1_4 Forward -88 -78 8.82982 0.0646
NP_440554.1_4 Reverse -81 -91 7.05986 0.106
NP_441885.1_5 Reverse -80 -90 20.9245 0.000538
NP_441885.1_5 Forward -89 -79 11.3864 0.00668
NP_440628.1_1 Forward -358 -348 13.1977 0.29
NP_442703.1_1 Reverse -267 -286 4.91741 0.297
NP_442341.1_9 Reverse -78 -92 17.9935 0.0212
NP_442341.1_9 Forward -91 -77 6.88214 0.21
NP_440409.1_1 Reverse -49 -68 3.34271 0.18
NP_443000.1_7 Forward -91 -81 17.0896 0.00865
NP_443000.1_7 Reverse -78 -88 10.6981 0.0345
NP_440552.1_8 Forward -194 -177 14.0895 0.175
NP_442513.1_5 Reverse -49 -68 5.60352 0.293
NP_441842.1_10 Reverse -73 -87 6.88276 0.271
NP_440275.1_3 Reverse -78 -88 9.02648 0.0563
NP_440275.1_3 Forward -91 -81 8.1415 0.0602
NP_440560.1_1 Reverse -140 -159 22.6344 0.0126
NP_440091.1_1 Forward -93 -81 16.4603 0.0153
NP_441902.1_3 Forward -376 -366 11.6212 0.293
NP_440679.1_3 Forward -115 -97 5.03403 0.296
NP_440880.1_2 Forward -236 -217 19.9096 0.115
NP_440149.1_8 Reverse -80 -99 -2.26216 0.166
NP_440216.1_1 Reverse -80 -94 7.9644 0.00737
NP_440216.1_1 Forward -89 -75 6.6861 0.0139
NP_440216.1_9 Reverse -10 -19 12.5861 0.227
NP_440172.1_1 Forward -89 -79 17.5813 0.00421
NP_440172.1_1 Reverse -80 -90 15.0247 0.00945
NP_442015.1_10 Reverse -76 -89 2.47756 0.191
NP_442015.1_10 Forward -93 -80 0.60927 0.221
NP_441226.1_7 Forward -88 -81 14.4934 0.0123
NP_441226.1_7 Reverse -81 -88 14.4934 0.0123
NP_441111.1_7 Forward -88 -80 18.7023 0.00294
NP_441111.1_7 Reverse -81 -89 18.7023 0.00294
NP_442379.1_10 Forward -96 -79 15.1818 0.0453
NP_441766.1_2 Forward -89 -80 17.5026 0.00297
NP_441766.1_2 Reverse -80 -89 17.5026 0.00297
NP_442417.1_5 Forward -89 -75 7.07942 0.197
NP_443052.1_8 Forward -99 -80 -8.85033 0.179
NP_442116.1_6 Forward -199 -182 5.2087 0.299
NP_440261.1_5 Forward -88 -75 -10.6005 0.201
NP_440261.1_5 Reverse -81 -94 -10.6005 0.201
NP_440988.1_10 Forward -91 -77 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGTTCATAATAATTCTAGGCGCTTGGAGCAATAAGAATGATATATAGAGAAAACTAAAAGATTACATTCTAGCATGTCAATAAAAAATAGTAATTCACTTCTCTGACTTATCTTTTATTTCTTTTTTTTTATTTGAGATTAATTTTGGAACATAAAAATCAAGAAAATCAGTAATATTTAATATTTTTTGCTGTTCCTTTTATATTCAAGAATAATTTAAAGATTATCGCACCTAAATTTTCGTTTTTGGGCAATTATTCTGATCTGAGGGCGGGTCAATTTTAGGCAAACCCGTCATAGCCGAGCAAATGGCGATCGCCTAGCTAACTGCCATGTCATCGCAATCAGTGCCAGGAGAATGTCAGAATAGGGGCAACTTGTTTTCCTTGCCCTGAAACC

CDS

ATGTCAACCCAGCTTGATAACATCACTTCCGCGGAAACTGCCCCCGATTATTTGGACGAAGTGCCCGATGACGTGGAAATGTCTTTGTTTGATCACCTCGACGAACTCAGAACTCGTATTTTTCTGTCTTTGGGGGCGGTCTTGGTCGGGGTAGTGGCCTGCTTTATTTTCGTTAAACCCTTGGTGCAATGGCTTCAAGTCCCGGCAGGCACAGTTAAATTTCTGCAGCTCTCCCCAGGGGAATTCTTTTTCGTTTCCGTCAAAGTAGCAGGCTACAGCGGCATTCTGGTGATGAGCCCCTTTATCCTCTACCAAATTATTCAATTCGTTCTACCCGGTCTAACCCGTCGGGAACGCCGATTACTGGGACCGGTGGTGCTAGGCTCCAGTGTACTTTTTTTTGCTGGACTGGGCTTTGCTTACTATGCTCTCATCCCCGCCGCACTCAAGTTTTTTGTCAGCTACGGAGCGGATGTGGTGGAGCAACTCTGGTCGATTGATAAATATTTTGAGTTTGTGCTGTTGTTGATGTTTAGCACCGGGCTAGCTTTTCAAATTCCGATTATTCAAGTGGTTCTCGGCTTTTTGGGCATCGTTTCCTCCGAACAAATGCTCAAGGGCTGGCGCTTTGTCATTTTGGGGGCGATGGTGCTGGGGGCAATTCTCACCCCTTCCACGGACCCCCTGACCCAGTCCCTTCTAGCTGGGGCAGTGCTGGGGCTTTACTTTGGCGGGATCGGTTGCGTGCGCTTACTGGGTAAATAG

Protein

MSTQLDNITSAETAPDYLDEVPDDVEMSLFDHLDELRTRIFLSLGAVLVGVVACFIFVKPLVQWLQVPAGTVKFLQLSPGEFFFVSVKVAGYSGILVMSPFILYQIIQFVLPGLTRRERRLLGPVVLGSSVLFFAGLGFAYYALIPAALKFFVSYGADVVEQLWSIDKYFEFVLLLMFSTGLAFQIPIIQVVLGFLGIVSSEQMLKGWRFVILGAMVLGAILTPSTDPLTQSLLAGAVLGLYFGGIGCVRLLGK