Your browser is old and dusty. Try Google Chrome!

Details for sll0189

ORF sll0189
Accession NP_442338.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -284 -298 12.8809 0.201
NP_441061.1_2 Forward -372 -358 7.37441 0.104
NP_440795.1_7 Reverse -223 -230 6.92228 0.26
NP_441418.1_6 Reverse -307 -326 -29.0082 0.215
NP_441418.1_6 Reverse -343 -362 -29.8932 0.245
NP_441418.1_6 Reverse -235 -254 -30.3848 0.274
NP_441418.1_6 Reverse -216 -235 -30.7781 0.296
NP_440815.1_5 Forward -95 -76 3.53937 0.286
NP_442291.1_7 Forward -326 -312 16.9125 0.211
NP_442291.1_7 Reverse -42 -56 9.83269 0.259
NP_441453.1_7 Reverse -289 -296 13.4121 0.23
NP_441453.1_8 Forward -132 -115 8.00365 0.25
NP_442151.1_6 Reverse -122 -136 7.47274 0.197
NP_441818.1_9 Reverse -229 -248 9.24257 0.112
NP_441818.1_9 Reverse -235 -254 3.6377 0.18
NP_441818.1_9 Reverse -217 -236 1.67108 0.191
NP_441818.1_9 Reverse -223 -242 1.17943 0.191
NP_441818.1_9 Reverse -211 -230 -1.08219 0.198
NP_441818.1_9 Reverse -205 -224 -10.3253 0.292
NP_441818.1_9 Reverse -368 -387 -10.6203 0.296
NP_441818.1_9 Reverse -220 -239 -10.817 0.299
NP_441818.1_9 Reverse -122 -141 -11.0136 0.3
NP_442169.1_1 Reverse -219 -238 -1.08219 0.262
NP_442744.1_8 Reverse -333 -352 -5.9004 0.297
NP_442287.1_1 Forward -245 -235 14.0409 0.266
NP_442752.1_4 Reverse -326 -333 5.25066 0.256
NP_441225.1_2 Forward -142 -123 0.884433 0.267
NP_440061.1_9 Reverse -233 -247 6.68548 0.235
NP_440061.1_9 Forward -248 -234 5.89884 0.266
NP_440110.1_8 Reverse -308 -327 -2.65548 0.279
NP_441054.1_2 Reverse -217 -236 12.1925 0.244
NP_441476.1_5 Reverse -335 -354 8.45592 0.0945
NP_439979.1_2 Reverse -307 -326 8.75091 0.256
NP_439979.1_2 Forward -364 -345 6.29264 0.292
NP_439979.1_7 Forward -397 -380 13.0185 0.3
NP_442062.1_10 Forward -61 -42 12.5858 0.236
NP_441900.1_2 Forward -260 -242 0.116744 0.258
NP_441802.1_1 Forward -118 -99 10.5209 0.197
NP_440304.1_4 Reverse -317 -327 3.61828 0.295
NP_440044.1_1 Forward -235 -216 10.7175 0.284
NP_441781.1_2 Reverse -323 -342 18.05 0.288
NP_439918.1_2 Reverse -80 -99 -3.44213 0.254
NP_439918.1_2 Reverse -211 -230 -3.73712 0.261
NP_441200.1_4 Reverse -69 -88 5.30933 0.295
NP_441208.1_1 Reverse -44 -63 0.982764 0.247
NP_440132.1_1 Reverse -341 -359 10.0489 0.223
NP_442110.1_7 Reverse -79 -93 6.98109 0.128
NP_441082.1_10 Reverse -230 -243 9.95071 0.237
NP_441082.1_10 Reverse -124 -137 9.06573 0.257
NP_441925.1_4 Forward -335 -316 -5.21283 0.177
NP_441925.1_4 Forward -316 -297 -5.40949 0.177
NP_441925.1_4 Forward -377 -358 -7.08111 0.188
NP_441925.1_4 Forward -319 -300 -7.47443 0.195
NP_441925.1_4 Forward -244 -225 -8.35941 0.209
NP_441925.1_4 Forward -235 -216 -11.506 0.252
NP_441925.1_4 Forward -313 -294 -11.8993 0.253
NP_441925.1_4 Forward -54 -35 -14.1609 0.261
NP_441925.1_4 Forward -233 -214 -14.6526 0.263
NP_441925.1_4 Forward -245 -226 -14.8492 0.263
NP_441925.1_4 Forward -326 -307 -15.2425 0.263
NP_441925.1_4 Forward -327 -308 -15.4392 0.264
NP_441925.1_4 Forward -236 -217 -15.7342 0.273
NP_441925.1_4 Forward -238 -219 -16.2258 0.281
NP_441925.1_4 Forward -251 -232 -16.9142 0.287
NP_441925.1_4 Forward -248 -229 -17.1108 0.288
NP_441083.1_3 Forward -56 -46 17.9741 0.0636
NP_441083.1_5 Forward -335 -325 4.79825 0.13
NP_442889.1_1 Reverse -229 -248 -13.5702 0.262
NP_441770.1_1 Forward -238 -219 12.585 0.277
NP_441770.1_10 Forward -325 -306 13.5691 0.213
NP_442570.1_3 Reverse -120 -139 1.27776 0.198
NP_442570.1_3 Reverse -114 -133 -7.27704 0.269
NP_441598.1_5 Reverse -223 -242 16.7157 0.192
NP_441598.1_5 Reverse -232 -251 15.0441 0.192
NP_440343.1_3 Forward -334 -316 11.4247 0.149
NP_440343.1_3 Forward -341 -323 3.75497 0.266
NP_440343.1_6 Reverse -228 -247 12.3892 0.238
NP_440343.1_9 Reverse -240 -259 16.2241 0.139
NP_440747.1_10 Forward -319 -307 -11.9574 0.178
NP_442760.1_4 Forward -338 -319 11.6025 0.222
NP_440403.1_4 Forward -255 -236 -9.93197 0.288
NP_440403.1_10 Reverse -318 -337 0.786102 0.296
NP_440403.1_10 Reverse -324 -343 0.687771 0.3
NP_440842.1_10 Forward -247 -233 0.88457 0.296
NP_441695.1_4 Forward -371 -353 12.2122 0.225
NP_441695.1_4 Forward -230 -212 10.1472 0.288
NP_441014.1_5 Forward -59 -41 12.7038 0.231
NP_441014.1_8 Forward -335 -316 -2.55715 0.233
NP_441014.1_8 Forward -371 -352 -3.73712 0.242
NP_441014.1_8 Forward -327 -308 -5.9004 0.275
NP_441014.1_8 Forward -319 -300 -6.39206 0.276
NP_442848.1_5 Forward -238 -220 13.0972 0.232
NP_442848.1_5 Forward -247 -229 -0.964162 0.276
NP_441012.1_4 Forward -235 -222 9.85238 0.272
NP_441634.1_5 Reverse -32 -46 19.4691 0.107
NP_440376.1_1 Forward -246 -237 6.09625 0.111
NP_440376.1_1 Forward -316 -307 5.60459 0.125
NP_442191.1_4 Reverse -284 -298 10.7992 0.288
NP_442589.1_8 Reverse -320 -334 10.816 0.249
NP_442485.1_2 Reverse -376 -395 9.63589 0.288
NP_442485.1_3 Reverse -322 -341 -5.9004 0.296
NP_441846.1_10 Reverse -247 -266 -13.9635 0.216
NP_441846.1_10 Reverse -210 -229 -14.4552 0.227
NP_441846.1_10 Reverse -283 -302 -15.3402 0.247
NP_441846.1_10 Reverse -374 -393 -15.5368 0.252
NP_441846.1_10 Reverse -217 -236 -22.125 0.257
NP_441846.1_10 Reverse -307 -326 -22.3217 0.259
NP_441846.1_10 Reverse -325 -344 -23.2067 0.279
NP_441846.1_10 Reverse -294 -313 -23.4033 0.285
NP_441846.1_10 Reverse -300 -319 -23.7966 0.298
NP_442583.1_8 Forward -399 -380 8.65258 0.248
NP_440642.1_10 Reverse -94 -108 1.86729 0.287
NP_440042.1_2 Forward -203 -184 -4.32711 0.293
NP_440691.1_3 Reverse -205 -224 14.3558 0.269
NP_440667.1_2 Reverse -217 -236 0.982764 0.208
NP_440667.1_2 Reverse -358 -377 -5.50708 0.261
NP_441950.1_7 Reverse -229 -248 7.07928 0.133
NP_441950.1_7 Reverse -358 -377 -0.590531 0.191
NP_441950.1_7 Reverse -220 -239 -7.96535 0.283
NP_442296.1_5 Forward -259 -240 -0.197208 0.293
NP_440360.1_10 Forward -326 -312 6.48943 0.227
NP_442658.1_1 Reverse -317 -327 4.7978 0.297
NP_440141.1_3 Forward -372 -353 0.786102 0.277
NP_440141.1_8 Forward -131 -112 8.55425 0.23
NP_440141.1_8 Reverse -318 -337 7.47261 0.24
NP_442782.1_2 Forward -88 -74 1.47456 0.281
NP_442782.1_2 Reverse -364 -378 1.27789 0.281
NP_442782.1_2 Reverse -75 -89 -0.000409212 0.297
NP_442205.1_9 Reverse -358 -374 -2.5964 0.272
NP_439968.1_2 Forward -238 -219 13.5683 0.257
NP_440607.1_8 Reverse -233 -252 4.12936 0.209
NP_441256.1_2 Reverse -76 -95 13.7658 0.132
NP_439959.1_3 Reverse -238 -257 9.43923 0.267
NP_442321.1_1 Reverse -362 -381 -6.88371 0.246
NP_442486.1_6 Forward -253 -234 -6.68705 0.296
NP_439905.1_1 Forward -372 -359 14.3756 0.127
NP_439905.1_1 Forward -82 -69 7.49244 0.258
NP_439905.1_2 Forward -378 -364 10.7177 0.208
NP_440984.1_7 Reverse -230 -244 15.8309 0.0488
NP_441338.2_4 Reverse -27 -46 15.7324 0.114
NP_440153.1_8 Forward -231 -218 6.90245 0.17
NP_440153.1_8 Forward -142 -129 -2.93064 0.268
NP_440153.1_8 Forward -379 -366 -3.52063 0.295
NP_442064.1_4 Reverse -112 -131 8.65176 0.23
NP_442064.1_4 Reverse -118 -137 4.71854 0.285
NP_441891.1_8 Reverse -228 -247 15.9291 0.282
NP_440138.1_6 Forward -93 -74 10.7167 0.157
NP_440138.1_6 Forward -130 -111 2.26028 0.269
NP_442853.1_10 Forward -246 -227 10.1267 0.24
NP_441099.1_3 Reverse -81 -100 2.26107 0.279
NP_442002.1_1 Reverse -324 -342 -6.76569 0.249
NP_440475.1_5 Forward -109 -90 10.0292 0.175
NP_440411.1_10 Reverse -78 -97 10.8472 0.27
NP_441646.1_1 Reverse -320 -339 3.24438 0.207
NP_441646.1_1 Reverse -79 -98 2.75272 0.214
NP_442438.1_10 Forward -357 -343 3.24451 0.165
NP_442431.1_10 Reverse -232 -250 15.1621 0.0631
NP_442431.1_10 Reverse -352 -370 7.68896 0.167
NP_442431.1_10 Reverse -223 -241 4.9357 0.206
NP_442431.1_10 Reverse -202 -220 3.95239 0.213
NP_442431.1_10 Reverse -214 -232 1.78911 0.247
NP_441752.1_6 Forward -263 -244 6.88262 0.211
NP_441752.1_6 Forward -374 -355 2.94938 0.235
NP_442771.1_1 Reverse -341 -359 2.87075 0.0672
NP_442771.1_1 Reverse -305 -323 0.707465 0.0909
NP_441916.1_7 Forward -316 -306 2.83163 0.239
NP_441916.1_7 Forward -246 -236 2.83163 0.239
NP_441041.1_4 Reverse -352 -371 -1.57384 0.101
NP_441041.1_4 Reverse -307 -326 -9.14533 0.213
NP_441041.1_4 Reverse -74 -93 -10.3253 0.231
NP_441041.1_4 Reverse -315 -334 -11.4069 0.246
NP_440289.1_2 Forward -249 -236 8.86907 0.0411
NP_440983.1_5 Forward -243 -224 15.6341 0.0965
NP_440983.1_5 Forward -101 -82 -4.52377 0.257
NP_440260.1_8 Forward -352 -334 -4.01242 0.263
NP_441514.1_6 Reverse -390 -397 14.2971 0.248
NP_441678.1_2 Forward -354 -335 5.99764 0.299
NP_441678.1_9 Reverse -74 -93 0.982764 0.223
NP_441678.1_9 Reverse -369 -388 -2.85214 0.272
NP_442281.1_1 Forward -340 -326 4.62054 0.187
NP_442281.1_1 Forward -236 -222 2.75226 0.257
NP_440018.1_3 Forward -243 -224 7.86593 0.209
NP_442575.1_8 Reverse -352 -371 1.96607 0.196
NP_442256.1_2 Forward -246 -228 -8.53565 0.227
NP_442012.1_5 Reverse -293 -312 7.47261 0.252
NP_441457.1_2 Forward -377 -358 18.584 0.111
NP_440867.1_10 Reverse -310 -329 3.04771 0.283
NP_442215.1_2 Forward -351 -335 -3.8747 0.223
NP_442029.1_6 Reverse -130 -149 3.53937 0.282
NP_442029.1_6 Forward -59 -40 2.55606 0.294
NP_440566.1_6 Reverse -77 -96 14.3558 0.18
NP_442926.1_3 Reverse -308 -327 2.45773 0.295
NP_442554.1_4 Reverse -332 -351 8.65258 0.29
NP_442142.1_4 Forward -247 -234 4.73861 0.212
NP_442142.1_4 Forward -253 -240 4.05029 0.234
NP_443009.1_5 Reverse -283 -294 5.46638 0.202
NP_442406.1_9 Reverse -326 -345 -0.197208 0.291
NP_442301.1_2 Forward -241 -222 12.0933 0.159
NP_442301.1_2 Forward -238 -219 9.7334 0.2
NP_442408.2_5 Reverse -129 -148 19.4774 0.186
NP_442338.1_6 Forward -256 -237 22.6156 0.0325
NP_442338.1_8 Forward -315 -296 23.0089 0.0263
NP_442338.1_9 Forward -161 -142 19.764 0.188
NP_440357.1_3 Reverse -324 -343 0.982764 0.278
NP_440357.1_6 Forward -235 -216 2.3594 0.296
NP_441448.1_1 Reverse -308 -327 5.60432 0.261
NP_440379.1_5 Forward -382 -363 -4.72043 0.215
NP_440379.1_5 Reverse -324 -343 -8.752 0.254
NP_440379.1_5 Reverse -376 -395 -10.1286 0.276
NP_440464.1_10 Forward -243 -233 13.0082 0.169
NP_441468.1_1 Reverse -236 -243 6.72562 0.126
NP_441020.2_6 Reverse -317 -334 8.98696 0.182
NP_441020.2_6 Reverse -233 -250 8.49531 0.197
NP_441020.2_6 Reverse -214 -231 6.33202 0.267
NP_441015.1_10 Reverse -359 -378 7.17762 0.0996
NP_441015.1_10 Reverse -308 -327 -0.4922 0.169
NP_441015.1_10 Reverse -223 -242 -7.08038 0.262
NP_441015.1_10 Reverse -217 -236 -8.752 0.277
NP_441015.1_10 Reverse -365 -384 -10.1286 0.283
NP_441015.1_10 Reverse -314 -333 -10.6203 0.286
NP_441015.1_10 Reverse -245 -264 -10.9153 0.289
NP_441673.1_1 Reverse -237 -246 -7.86675 0.187
NP_441673.1_1 Forward -246 -237 -7.96508 0.206
NP_441731.1_9 Reverse -227 -244 16.4601 0.201
NP_441876.1_9 Reverse -44 -54 10.1076 0.3
NP_441826.1_5 Forward -369 -350 3.14605 0.271
NP_441826.1_5 Reverse -322 -341 2.16274 0.276
NP_442490.1_9 Reverse -307 -326 4.03102 0.165
NP_442227.1_2 Forward -235 -216 1.86774 0.242
NP_442227.1_2 Forward -232 -213 0.786102 0.252
NP_442227.1_2 Forward -371 -352 -1.96717 0.269
NP_440789.1_8 Forward -116 -97 24.0905 0.0162
NP_442808.1_1 Forward -317 -307 6.56775 0.107
NP_442808.1_1 Forward -343 -333 5.09279 0.173
NP_442808.1_1 Forward -227 -217 3.32285 0.244
NP_442808.1_1 Forward -139 -129 1.5529 0.282
NP_441101.1_3 Reverse -35 -54 11.7992 0.293
NP_440918.1_2 Reverse -220 -239 9.24257 0.299
NP_442775.1_6 Reverse -289 -308 13.9625 0.268
NP_442775.1_6 Reverse -217 -236 10.2259 0.277
NP_442820.1_10 Forward -357 -339 15.2604 0.152
NP_442718.1_2 Reverse -130 -149 -2.36049 0.277
NP_442113.1_4 Reverse -348 -367 18.1907 0.158
NP_442342.1_9 Forward -351 -335 6.9417 0.217
NP_440630.1_7 Forward -336 -317 -7.37537 0.287
NP_440342.1_2 Reverse -318 -337 15.8307 0.124
NP_440558.1_2 Forward -58 -39 1.27776 0.182
NP_440558.1_2 Forward -52 -33 -1.86883 0.218
NP_440558.1_5 Reverse -86 -100 15.5359 0.25
NP_441878.1_6 Reverse -318 -328 1.06167 0.116
NP_441878.1_6 Reverse -45 -55 0.275027 0.146
NP_441878.1_6 Reverse -236 -246 -7.29646 0.217
NP_441878.1_6 Reverse -339 -349 -7.68978 0.255
NP_441878.1_6 Reverse -306 -316 -7.68978 0.255
NP_441878.1_6 Forward -247 -237 -7.98478 0.285
NP_441557.1_8 Forward -393 -383 12.8609 0.235
NP_442356.1_1 Reverse -193 -212 10.4225 0.256
NP_441445.1_1 Reverse -219 -238 9.73422 0.103
NP_441445.1_1 Reverse -298 -317 0.687771 0.27
NP_441590.1_1 Forward -247 -228 10.5209 0.256
NP_441590.1_4 Forward -327 -308 8.94676 0.249
NP_441590.1_4 Forward -230 -211 5.2102 0.279
NP_441590.1_4 Forward -236 -217 4.71854 0.279
NP_441590.1_4 Forward -343 -324 2.9486 0.29
NP_441590.1_4 Forward -376 -357 2.75194 0.293
NP_441590.1_4 Forward -244 -225 1.76863 0.299
NP_441308.1_3 Forward -130 -111 9.63589 0.261
NP_440101.1_3 Reverse -359 -378 7.27595 0.177
NP_440101.1_3 Reverse -224 -243 3.53937 0.227
NP_442830.1_5 Forward -336 -322 5.89884 0.225
NP_442830.1_5 Forward -343 -329 4.03056 0.239
NP_442166.1_7 Reverse -308 -322 8.35772 0.24
NP_441574.1_1 Reverse -307 -326 -5.40875 0.26
NP_441574.1_1 Reverse -321 -340 -7.17871 0.286
NP_442170.1_4 Reverse -343 -362 9.93088 0.251
NP_442965.1_2 Reverse -334 -353 -6.1954 0.257
NP_442594.1_8 Reverse -217 -236 8.16093 0.206
NP_442594.1_8 Reverse -324 -343 3.73603 0.279
NP_442594.1_8 Reverse -331 -350 1.86774 0.295
NP_442508.1_8 Reverse -121 -138 11.7402 0.256
NP_440151.1_5 Reverse -229 -248 3.34271 0.288
NP_441633.1_3 Forward -248 -235 -3.91395 0.177
NP_442590.1_9 Reverse -309 -328 9.63589 0.23
NP_442590.1_10 Forward -335 -316 14.9458 0.113
NP_442998.1_5 Reverse -247 -257 10.7964 0.204
NP_440299.1_1 Forward -320 -307 8.96682 0.0819
NP_440640.1_6 Reverse -346 -365 1.37609 0.266
NP_442802.1_2 Forward -326 -307 13.47 0.235
NP_441007.1_10 Reverse -359 -372 3.26421 0.182
NP_441007.1_10 Reverse -314 -327 1.59258 0.203
NP_441007.1_10 Reverse -232 -245 0.707601 0.219
NP_441007.1_10 Reverse -217 -230 -1.06236 0.3
NP_442201.1_10 Reverse -306 -325 -13.5702 0.274
NP_440256.1_1 Reverse -76 -95 -4.6221 0.161
NP_440256.1_1 Forward -370 -351 -8.06369 0.251
NP_440087.1_1 Reverse -317 -336 -4.6221 0.246
NP_441229.1_9 Reverse -238 -257 8.16093 0.161
NP_442007.1_8 Forward -254 -236 10.7364 0.258
NP_441559.1_8 Forward -297 -283 -5.11362 0.248
NP_441559.1_8 Reverse -112 -126 -7.08024 0.283
NP_441270.1_4 Forward -241 -222 15.8299 0.245
NP_441270.1_4 Forward -331 -312 14.6499 0.251
NP_440915.1_6 Forward -361 -347 7.76774 0.0654
NP_440915.1_6 Reverse -315 -329 1.57289 0.134
NP_440915.1_6 Reverse -359 -373 -3.34366 0.293
NP_440915.1_6 Reverse -322 -336 -3.54032 0.298
NP_441296.1_9 Forward -400 -387 11.7201 0.231
NP_440717.1_3 Forward -377 -363 8.3571 0.267
NP_442866.1_1 Reverse -117 -136 2.26107 0.158
NP_440748.1_5 Forward -235 -216 3.24438 0.21
NP_440748.1_5 Forward -92 -73 -1.86883 0.27
NP_441464.1_8 Forward -246 -232 3.63784 0.291
NP_441464.1_10 Reverse -215 -229 15.2409 0.166
NP_441464.1_10 Reverse -226 -240 7.76774 0.292
NP_442957.1_9 Forward -103 -84 8.16093 0.189
NP_442993.1_1 Forward -357 -341 -12.5278 0.274
NP_442386.1_9 Forward -343 -334 7.57079 0.219
NP_442386.1_10 Reverse -319 -332 3.5592 0.273
NP_441750.1_1 Reverse -355 -374 3.04771 0.128
NP_441750.1_7 Reverse -228 -238 17.6796 0.254
NP_440168.1_6 Forward -341 -322 15.5349 0.236
NP_440327.1_6 Reverse -217 -236 8.06259 0.222
NP_442240.1_1 Forward -344 -325 16.2232 0.167
NP_441160.1_6 Forward -371 -352 -3.44213 0.286
NP_440586.1_1 Reverse -366 -385 1.47442 0.231
NP_440586.1_1 Reverse -221 -240 -1.27885 0.237
NP_440586.1_1 Reverse -231 -250 -4.42544 0.278
NP_440192.1_5 Reverse -293 -312 8.45592 0.204
NP_440192.1_5 Reverse -68 -87 3.44104 0.273
NP_440027.1_3 Forward -383 -365 11.5231 0.159
NP_440027.1_3 Reverse -348 -366 9.35981 0.184
NP_440027.1_3 Forward -244 -226 8.08151 0.196
NP_440027.1_3 Forward -329 -311 2.87 0.284
NP_440027.1_3 Forward -335 -317 2.57501 0.289
NP_440027.1_3 Forward -253 -235 1.88669 0.295
NP_440027.1_3 Forward -237 -219 1.5917 0.3
NP_439984.1_10 Forward -255 -241 13.2736 0.186
NP_439937.1_8 Reverse -365 -384 -5.11376 0.286
NP_439937.1_9 Forward -206 -189 -15.0064 0.287
NP_439937.1_9 Forward -353 -336 -16.5797 0.287
NP_439937.1_9 Forward -49 -32 -17.268 0.296
NP_440408.1_7 Reverse -257 -276 8.84924 0.267
NP_440408.1_10 Reverse -364 -383 5.211 0.275
NP_440439.1_1 Reverse -380 -393 0.510939 0.188
NP_440439.1_1 Reverse -361 -374 0.510939 0.188
NP_440439.1_1 Forward -359 -346 -1.849 0.285
NP_442239.1_8 Reverse -219 -238 14.8474 0.205
NP_442239.1_8 Reverse -231 -250 12.0942 0.239
NP_442239.1_8 Reverse -354 -373 8.75091 0.249
NP_442239.1_8 Reverse -321 -340 5.89931 0.266
NP_439943.1_4 Reverse -116 -135 15.5357 0.111
NP_440271.1_3 Reverse -346 -365 12.2908 0.212
NP_440171.1_3 Reverse -245 -264 5.11266 0.284
NP_440171.1_3 Reverse -380 -399 3.24438 0.284
NP_441789.1_7 Forward -393 -374 4.52188 0.193
NP_441789.1_7 Forward -236 -217 1.27698 0.245
NP_441789.1_7 Forward -245 -226 -0.492971 0.251
NP_441789.1_7 Forward -344 -325 -0.689632 0.251
NP_440819.1_4 Reverse -212 -231 9.93088 0.242
NP_440316.1_10 Reverse -318 -328 17.8763 0.153
NP_440316.1_10 Reverse -332 -342 5.38824 0.299
NP_441803.1_2 Forward -372 -353 0.687771 0.247
NP_439977.1_5 Forward -320 -301 -2.65548 0.287
NP_440210.1_10 Reverse -95 -114 4.42355 0.296
NP_442384.1_10 Forward -335 -322 2.18257 0.235
NP_440364.1_2 Reverse -229 -248 14.2265 0.278
NP_442572.1_6 Reverse -343 -362 8.75091 0.238
NP_441018.1_7 Reverse -290 -309 13.7658 0.132
NP_441018.1_7 Reverse -70 -89 10.2259 0.214
NP_441018.1_7 Reverse -360 -379 6.98095 0.278
NP_440282.1_3 Forward -94 -75 -0.39387 0.291
NP_440531.1_6 Reverse -356 -375 4.62101 0.123
NP_441335.1_8 Forward -126 -107 7.27595 0.281
NP_441640.1_8 Reverse -117 -136 -4.32711 0.264
NP_442529.1_6 Reverse -223 -242 17.8957 0.232
NP_442693.1_7 Reverse -67 -86 7.37428 0.282
NP_440100.1_5 Forward -40 -21 22.1239 0.101
NP_440350.1_5 Reverse -83 -102 -5.01543 0.289
NP_442280.1_10 Reverse -176 -194 5.25962 0.289
NP_441103.1_9 Forward -398 -388 14.1497 0.23
NP_441103.1_9 Forward -390 -380 13.4661 0.259
NP_440700.1_8 Reverse -369 -383 15.9292 0.223
NP_442067.1_4 Forward -369 -350 3.53937 0.282
NP_440999.1_9 Forward -241 -227 2.85119 0.142
NP_440999.1_9 Forward -250 -236 -0.295402 0.203
NP_440999.1_9 Forward -320 -306 -1.47537 0.239
NP_440999.1_9 Forward -297 -283 -3.24533 0.289
NP_440888.1_2 Reverse -348 -362 9.34041 0.13
NP_442147.1_7 Reverse -226 -245 8.06259 0.288
NP_439969.1_3 Forward -340 -321 4.916 0.213
NP_442845.1_2 Reverse -229 -243 13.2743 0.0955
NP_442845.1_2 Reverse -320 -334 5.89945 0.22
NP_442845.1_2 Reverse -327 -341 5.70279 0.225
NP_441178.1_6 Forward -345 -326 1.08032 0.291
NP_442337.1_8 Reverse -29 -48 13.1758 0.131
NP_440710.1_1 Forward -317 -299 -2.24246 0.19
NP_440220.1_4 Forward -298 -279 6.48849 0.196
NP_441462.1_2 Forward -246 -236 -0.609952 0.24
NP_441462.1_2 Forward -316 -306 -0.806614 0.254
NP_441462.1_5 Reverse -245 -264 6.68596 0.218
NP_441621.1_7 Reverse -308 -322 -2.65535 0.188
NP_441601.1_4 Forward -371 -352 -1.7705 0.293
NP_441601.1_4 Reverse -350 -369 -2.26216 0.293
NP_441601.1_7 Forward -245 -226 17.0107 0.108
NP_442204.1_2 Reverse -345 -364 8.06259 0.26
NP_441351.1_8 Reverse -235 -254 0.0977854 0.292
NP_440255.1_8 Forward -102 -83 14.0434 0.28
NP_440516.1_8 Reverse -319 -328 -0.295266 0.232
NP_440516.1_8 Reverse -326 -335 -0.590259 0.283
NP_440673.1_2 Reverse -227 -246 14.1941 0.103
NP_440673.1_2 Reverse -360 -379 9.60917 0.24
NP_440673.1_7 Forward -390 -371 1.27776 0.253
NP_440865.1_9 Reverse -301 -320 -8.752 0.269
NP_441052.1_2 Forward -244 -234 6.17489 0.0916
NP_441893.1_8 Reverse -361 -380 13.5691 0.287
NP_440314.1_9 Forward -315 -296 -4.6221 0.211
NP_440314.1_9 Forward -245 -226 -7.17871 0.237
NP_441719.1_6 Forward -345 -326 10.1267 0.269
NP_441733.1_5 Forward -243 -224 15.4374 0.294
NP_441004.1_1 Reverse -219 -238 -0.0988766 0.122
NP_441004.1_1 Reverse -321 -340 -4.81876 0.174
NP_441004.1_1 Reverse -229 -248 -8.55534 0.2
NP_441004.1_1 Reverse -307 -326 -10.817 0.226
NP_441004.1_1 Reverse -358 -377 -15.9302 0.279
NP_441004.1_1 Reverse -365 -384 -16.9135 0.287
NP_441004.1_2 Reverse -316 -335 2.0644 0.216
NP_441004.1_2 Reverse -214 -233 -1.96717 0.263
NP_441004.1_4 Reverse -324 -334 15.123 0.167
NP_442813.1_4 Reverse -178 -197 -2.36049 0.269
NP_442813.1_4 Reverse -121 -140 -8.94866 0.299
NP_442873.1_5 Forward -265 -246 8.4551 0.259
NP_440296.1_10 Reverse -316 -335 -4.72043 0.209
NP_440296.1_10 Reverse -366 -385 -12.1936 0.269
NP_442694.1_4 Reverse -85 -94 11.3078 0.277
NP_442206.1_7 Forward -246 -227 10.4225 0.295
NP_442206.1_10 Forward -131 -116 0.766545 0.245
NP_442854.1_6 Reverse -74 -93 1.47442 0.279
NP_440328.1_8 Forward -253 -234 15.1498 0.294
NP_441966.1_7 Forward -377 -358 3.44025 0.197
NP_442586.1_6 Reverse -122 -141 9.63589 0.237
NP_442208.1_5 Reverse -325 -344 -5.60541 0.266
NP_441542.1_4 Reverse -110 -124 3.63784 0.267
NP_442515.1_1 Forward -247 -233 6.3911 0.0977
NP_440593.1_3 Forward -384 -365 -1.37718 0.211
NP_440593.1_3 Forward -284 -265 -7.17871 0.288
NP_440593.1_9 Forward -276 -262 11.0127 0.24
NP_441982.1_6 Forward -197 -188 10.5755 0.295
NP_440463.1_8 Forward -359 -340 7.49989 0.264
NP_441349.1_10 Reverse -297 -316 -9.047 0.281
NP_439960.1_10 Reverse -348 -366 2.37909 0.179
NP_439960.1_10 Forward -253 -235 -4.50408 0.293
NP_440474.1_8 Forward -318 -304 4.52221 0.276
NP_440726.1_2 Forward -326 -307 5.50599 0.224
NP_442168.1_4 Forward -118 -104 20.6491 0.239
NP_440588.1_2 Reverse -226 -245 -0.983855 0.155
NP_440195.1_4 Forward -372 -353 8.55425 0.207
NP_440195.1_4 Reverse -238 -257 4.52268 0.294
NP_440954.1_1 Reverse -222 -241 -12.0953 0.295
NP_442006.1_2 Reverse -370 -387 -5.36936 0.143
NP_442006.1_2 Reverse -235 -252 -14.5141 0.203
NP_442006.1_2 Reverse -378 -395 -18.5457 0.292
NP_441003.1_9 Forward -339 -320 2.94938 0.3
NP_440483.1_1 Forward -362 -343 -5.11376 0.222
NP_441078.1_4 Reverse -237 -246 -0.786921 0.207
NP_441078.1_4 Reverse -307 -316 -1.18024 0.237
NP_441078.1_4 Forward -246 -237 -1.96689 0.282
NP_440707.1_9 Reverse -356 -375 0.58944 0.293
NP_442443.1_1 Reverse -311 -330 8.65258 0.119
NP_442443.1_1 Reverse -356 -375 -4.52377 0.272
NP_441432.1_8 Reverse -85 -94 7.27622 0.101
NP_442320.1_9 Reverse -237 -251 13.0776 0.246
NP_441732.1_2 Forward -263 -247 -17.7394 0.292
NP_440760.1_1 Forward -246 -227 -22.715 0.267
NP_442797.1_1 Forward -371 -352 2.55606 0.212
NP_442797.1_7 Forward -343 -325 0.510803 0.274
NP_441057.1_4 Reverse -354 -372 -2.3408 0.272
NP_442727.1_2 Reverse -370 -384 21.0424 0.0879
NP_441072.1_2 Reverse -218 -237 9.43923 0.218
NP_440713.1_4 Reverse -354 -373 8.84924 0.159
NP_440757.1_7 Reverse -308 -326 2.96908 0.263
NP_441452.1_1 Forward -369 -350 14.3558 0.292
NP_440786.1_10 Forward -63 -44 17.3057 0.252
NP_441040.1_2 Reverse -220 -239 -16.4218 0.296
NP_439956.1_7 Reverse -117 -136 1.17943 0.292
NP_442008.1_2 Forward -253 -234 4.22769 0.242
NP_441800.1_7 Forward -311 -293 -1.16082 0.242
NP_440545.1_3 Reverse -339 -356 5.15205 0.0642
NP_440545.1_3 Forward -334 -317 -2.41943 0.184
NP_440545.1_3 Forward -356 -339 -4.38605 0.224
NP_440545.1_3 Forward -52 -35 -5.27103 0.245
NP_440025.1_4 Forward -365 -346 9.83255 0.288
NP_440831.1_3 Reverse -241 -260 9.88192 0.188
NP_440831.1_3 Reverse -310 -329 9.78484 0.188
NP_441629.1_3 Forward -386 -367 7.57013 0.178
NP_441923.1_6 Reverse -311 -325 8.25939 0.278
NP_440486.1_6 Forward -257 -238 6.19431 0.283
NP_440486.1_6 Reverse -326 -345 5.40766 0.297
NP_440459.1_2 Forward -261 -244 10.4619 0.198
NP_440459.1_2 Forward -255 -238 7.512 0.288
NP_440010.1_10 Reverse -238 -257 5.70265 0.23
NP_440010.1_10 Reverse -365 -384 2.0644 0.29
NP_442311.1_5 Forward -128 -109 5.11266 0.245
NP_442603.1_7 Forward -259 -245 5.99717 0.264
NP_441233.1_2 Reverse -214 -233 22.4189 0.0795
NP_441233.1_9 Forward -235 -216 11.1109 0.295
NP_440449.1_6 Forward -56 -38 5.82426 0.268
NP_441948.1_6 Forward -129 -112 13.9035 0.231
NP_441358.1_2 Reverse -244 -263 8.25926 0.246
NP_441358.1_2 Reverse -322 -341 5.89931 0.275
NP_442070.1_1 Reverse -290 -309 12.1925 0.261
NP_441895.1_10 Forward -129 -110 -18.4868 0.282
NP_440671.1_6 Forward -56 -37 12.29 0.231
NP_443026.1_5 Reverse -218 -237 4.22769 0.283
NP_443026.1_5 Reverse -217 -236 -5.80207 0.293
NP_441973.1_1 Reverse -110 -125 -0.118434 0.269
NP_441671.1_10 Reverse -353 -372 1.17943 0.273
NP_441813.1_7 Forward -244 -230 9.24208 0.259
NP_441239.1_9 Forward -133 -121 4.07055 0.264
NP_441239.1_9 Forward -330 -318 3.87389 0.272
NP_441239.1_9 Forward -344 -332 3.57889 0.283
NP_441239.1_9 Reverse -346 -358 3.08724 0.296
NP_441951.1_4 Reverse -355 -374 4.32602 0.273
NP_441951.1_4 Reverse -364 -383 1.76941 0.283
NP_440156.1_4 Reverse -172 -182 14.8275 0.176
NP_440400.1_1 Forward -253 -234 -1.08295 0.285
NP_441892.1_1 Reverse -355 -372 -4.68105 0.266
NP_441892.1_2 Reverse -227 -246 -0.590531 0.16
NP_440665.1_1 Reverse -346 -365 -5.01543 0.191
NP_440900.1_1 Reverse -76 -95 17.6007 0.106
NP_443035.1_10 Reverse -357 -374 5.64371 0.273
NP_441526.1_6 Reverse -220 -239 15.1424 0.219
NP_441526.1_6 Reverse -214 -233 9.14423 0.258
NP_440354.1_5 Reverse -36 -55 11.9958 0.174
NP_440412.1_5 Reverse -172 -191 11.2991 0.287
NP_442052.1_8 Reverse -44 -54 13.2547 0.253
NP_440546.1_4 Reverse -319 -329 10.3369 0.109
NP_440546.1_4 Reverse -326 -336 10.046 0.109
NP_440546.1_4 Reverse -333 -343 8.49468 0.186
NP_441230.1_5 Reverse -211 -230 1.76941 0.234
NP_440462.1_4 Reverse -228 -242 8.06273 0.268
NP_441474.1_1 Forward -242 -223 2.55527 0.247
NP_442402.1_9 Reverse -296 -315 13.6675 0.191
NP_441848.1_6 Forward -395 -376 16.5182 0.212
NP_441848.1_7 Reverse -170 -189 -1.96793 0.258
NP_442258.1_2 Forward -340 -321 4.32602 0.0976
NP_442460.1_9 Forward -259 -240 15.2408 0.247
NP_440696.1_3 Reverse -218 -236 2.87075 0.213
NP_440696.1_3 Reverse -225 -243 -3.91409 0.293
NP_440696.1_6 Reverse -359 -378 14.0608 0.194
NP_442409.1_6 Reverse -353 -372 15.6341 0.18
NP_442696.1_6 Forward -231 -212 -12.4886 0.252
NP_440505.1_1 Forward -206 -189 15.2794 0.273
NP_441536.1_7 Forward -244 -225 16.7149 0.188
NP_441252.1_6 Reverse -190 -197 11.6422 0.288
NP_441408.2_7 Reverse -362 -381 -1.96717 0.262
NP_440914.1_1 Forward -131 -121 7.73678 0.224
NP_442533.1_1 Reverse -219 -238 -6.68705 0.178
NP_442533.1_1 Reverse -365 -384 -11.6036 0.236
NP_442533.1_1 Reverse -217 -236 -14.6519 0.247
NP_442533.1_1 Reverse -226 -245 -15.2418 0.253
NP_442533.1_1 Reverse -207 -226 -17.0118 0.279
NP_442533.1_1 Reverse -202 -221 -17.8968 0.297
NP_442533.1_6 Forward -54 -45 7.27622 0.0928
NP_442533.1_6 Forward -244 -235 4.32629 0.184
NP_442533.1_6 Reverse -237 -246 3.24465 0.219
NP_442533.1_6 Forward -342 -333 3.04799 0.228
NP_442533.1_6 Forward -335 -326 2.75299 0.241
NP_442533.1_6 Reverse -364 -373 2.16301 0.27
NP_442533.1_6 Forward -328 -319 2.06468 0.275
NP_442533.1_6 Reverse -74 -83 1.57302 0.294
NP_442533.1_6 Forward -372 -363 1.47469 0.298
NP_442533.1_6 Forward -55 -46 1.37636 0.3
NP_442232.1_3 Reverse -133 -152 -15.7335 0.296
NP_442322.1_4 Forward -229 -212 -1.24015 0.226
NP_442322.1_4 Forward -375 -358 -9.30325 0.29
NP_441235.1_5 Reverse -208 -227 10.3242 0.297
NP_441028.1_6 Forward -347 -337 9.616 0.21
NP_441028.1_6 Reverse -108 -118 7.15773 0.23
NP_441527.1_4 Forward -112 -93 -3.77235 0.173
NP_441527.1_4 Forward -121 -102 -7.01908 0.229
NP_441527.1_4 Reverse -197 -216 -10.8388 0.275
NP_441527.1_4 Forward -115 -96 -11.3162 0.281
NP_440007.1_9 Forward -135 -121 1.67122 0.285
NP_440007.1_9 Forward -361 -347 0.786239 0.29
NP_442728.1_7 Forward -138 -124 10.9143 0.291
NP_443045.1_5 Reverse -314 -327 14.8246 0.253
NP_443045.1_9 Forward -336 -318 7.58986 0.272
NP_441602.1_3 Reverse -229 -248 4.42435 0.153
NP_441602.1_3 Reverse -223 -242 -2.16383 0.233
NP_441170.1_4 Reverse -125 -143 14.1788 0.166
NP_441106.1_1 Reverse -363 -372 3.04799 0.244
NP_441106.1_1 Forward -317 -308 2.55633 0.28
NP_001035870.1_10 Forward -116 -97 14.7794 0.202
NP_441286.1_1 Reverse -234 -246 -5.76255 0.223
NP_442881.1_3 Forward -227 -208 20.9431 0.11
NP_439955.1_10 Forward -248 -229 11.3067 0.282
NP_440886.1_4 Forward -246 -227 20.354 0.0874
NP_440886.1_7 Forward -226 -216 9.02601 0.0805
NP_440886.1_7 Forward -343 -333 3.8145 0.265
NP_440886.1_7 Forward -238 -228 3.22451 0.291
NP_440828.1_1 Reverse -347 -366 -1.08295 0.284
NP_440828.1_1 Forward -386 -367 -1.8696 0.294
NP_442072.1_9 Reverse -78 -96 -23.187 0.284
NP_442401.1_2 Forward -238 -219 10.9134 0.171
NP_442401.1_2 Forward -247 -228 6.48849 0.299
NP_442213.1_5 Reverse -230 -249 -0.0988766 0.276
NP_441808.1_8 Reverse -229 -248 9.43923 0.259
NP_441808.1_8 Reverse -346 -365 9.14423 0.259
NP_441808.1_8 Reverse -238 -257 8.75091 0.259
NP_442022.1_4 Reverse -223 -242 11.2092 0.217
NP_441905.1_9 Forward -114 -95 8.65258 0.288
NP_442459.1_9 Reverse -364 -383 19.2723 0.0873
NP_442211.1_3 Reverse -352 -371 8.73642 0.273
NP_442221.1_4 Reverse -348 -367 11.0125 0.282
NP_442362.1_7 Reverse -323 -341 9.95058 0.289
NP_442794.1_1 Forward -135 -123 4.16888 0.276
NP_441962.1_5 Forward -332 -313 6.58763 0.278
NP_440387.1_1 Reverse -307 -323 -6.52964 0.292
NP_440855.1_5 Forward -324 -305 7.27514 0.285
NP_441431.1_2 Reverse -316 -330 10.0287 0.17
NP_441431.1_2 Forward -376 -362 8.45543 0.216
NP_441431.1_2 Forward -135 -121 6.78381 0.261
NP_441431.1_2 Forward -249 -235 6.68548 0.263
NP_441431.1_2 Forward -319 -305 6.48882 0.269
NP_441431.1_3 Reverse -327 -346 15.5357 0.162
NP_441488.1_3 Reverse -371 -389 17.8874 0.239
NP_441836.1_2 Reverse -357 -376 -6.39206 0.297
NP_441993.1_1 Reverse -307 -326 4.67549 0.215
NP_441993.1_1 Reverse -358 -377 0.679741 0.294
NP_441993.1_1 Reverse -219 -238 0.679741 0.294
NP_441993.1_1 Reverse -294 -313 0.484826 0.298
NP_440358.1_8 Forward -77 -58 0.392778 0.263
NP_442805.1_5 Forward -229 -210 -2.16459 0.262
NP_442805.1_5 Forward -235 -216 -5.70449 0.277
NP_442437.1_3 Forward -69 -50 16.8132 0.106
NP_442323.1_7 Forward -341 -322 9.24175 0.159
NP_441510.2_7 Forward -237 -223 11.5037 0.28
NP_440287.1_5 Reverse -107 -126 8.84842 0.286
NP_441720.1_4 Forward -236 -217 21.0414 0.248
NP_440293.1_3 Reverse -362 -381 -1.7705 0.239
NP_440293.1_3 Reverse -229 -248 -4.52377 0.264
NP_440293.1_3 Reverse -298 -317 -5.50708 0.279
NP_440293.1_9 Reverse -217 -231 14.7264 0.184
NP_440632.1_7 Forward -241 -222 3.44104 0.284
NP_439988.1_3 Reverse -322 -336 16.2242 0.172
NP_439988.1_3 Reverse -124 -138 7.66941 0.273
NP_441237.1_9 Reverse -327 -337 13.0581 0.0954
NP_442743.1_1 Forward -352 -333 10.9134 0.241
NP_441133.1_1 Reverse -229 -248 19.174 0.12
NP_441133.1_1 Reverse -307 -326 12.4875 0.269
NP_440457.1_1 Reverse -322 -334 1.80894 0.223
NP_440457.1_1 Reverse -315 -327 -0.256015 0.259
NP_440457.1_1 Reverse -218 -230 -0.452677 0.263
NP_440798.1_6 Forward -334 -321 0.707601 0.251
NP_440801.1_8 Forward -317 -298 -1.86883 0.283
NP_442297.1_4 Reverse -213 -232 11.6543 0.294
NP_441984.1_1 Reverse -223 -241 8.18062 0.262
NP_441984.1_1 Reverse -214 -232 5.23069 0.296
NP_441984.1_3 Forward -142 -124 5.82068 0.276
NP_441332.1_6 Forward -272 -262 13.3894 0.189
NP_441332.1_6 Forward -343 -333 13.0989 0.19
NP_441332.1_6 Forward -138 -128 12.3244 0.234
NP_441436.1_2 Reverse -380 -399 3.24438 0.217
NP_441436.1_8 Reverse -223 -242 10.0292 0.262
NP_441436.1_9 Forward -397 -387 16.4991 0.27
NP_440473.1_1 Forward -326 -307 12.8963 0.213
NP_442341.1_9 Reverse -324 -338 8.84875 0.164
NP_441756.1_5 Forward -248 -229 3.24438 0.2
NP_440409.1_10 Reverse -357 -376 7.37428 0.29
NP_440727.1_2 Reverse -227 -246 -3.24547 0.295
NP_440727.1_5 Reverse -228 -242 20.0591 0.0934
NP_440275.1_3 Reverse -341 -351 5.97822 0.129
NP_440275.1_3 Forward -318 -308 1.84832 0.282
NP_440679.1_10 Reverse -357 -376 -12.4886 0.198
NP_440679.1_10 Reverse -228 -247 -18.4868 0.278
NP_441359.1_2 Forward -383 -364 16.1257 0.219
NP_442451.1_2 Forward -254 -235 -10.227 0.265
NP_439962.1_4 Forward -372 -353 4.42435 0.179
NP_439962.1_4 Forward -248 -229 -4.72043 0.272
NP_439962.1_4 Forward -390 -371 -5.50708 0.28
NP_439962.1_4 Forward -245 -226 -6.1954 0.281
NP_439962.1_4 Reverse -235 -254 -7.76869 0.29
NP_439962.1_4 Forward -381 -362 -8.65367 0.298
NP_439962.1_4 Forward -239 -220 -8.94866 0.298
NP_440175.1_7 Reverse -118 -136 11.7053 0.23
NP_442495.1_4 Reverse -38 -48 12.5664 0.224
NP_442495.1_5 Forward -353 -334 11.6025 0.23
NP_442495.1_5 Reverse -232 -251 6.88262 0.291
NP_441105.1_3 Reverse -230 -249 -8.16202 0.267
NP_442373.1_2 Reverse -352 -371 -6.78538 0.233
NP_442373.1_2 Reverse -367 -386 -9.14533 0.258
NP_440216.1_9 Reverse -48 -57 5.50626 0.292
NP_442015.1_10 Reverse -336 -349 1.9859 0.204
NP_441226.1_7 Forward -225 -218 5.34865 0.289
NP_441226.1_7 Forward -136 -129 5.34865 0.289
NP_442834.1_9 Reverse -239 -258 8.75091 0.176
NP_440244.1_1 Reverse -376 -395 0.392778 0.187
NP_439971.2_8 Reverse -383 -397 13.6676 0.284
NP_441766.1_9 Forward -394 -375 2.75272 0.236
NP_441766.1_9 Reverse -311 -330 -2.85214 0.288
NP_440416.1_1 Forward -357 -338 -14.3569 0.287
NP_440416.1_9 Forward -323 -304 -13.6686 0.169
NP_440416.1_9 Reverse -121 -140 -16.7168 0.22
NP_443052.1_9 Forward -374 -355 18.0924 0.0276
NP_443052.1_9 Forward -248 -229 8.84924 0.115
NP_443052.1_9 Forward -371 -352 4.22769 0.156
NP_443052.1_9 Forward -257 -238 -0.000545616 0.203
NP_443052.1_9 Forward -398 -379 -0.39387 0.209
NP_443052.1_9 Forward -307 -288 -3.54046 0.25
NP_443052.1_9 Forward -377 -358 -5.01543 0.265
NP_440072.1_5 Reverse -210 -228 -1.06249 0.255
NP_442154.1_1 Reverse -214 -232 1.98577 0.0787
NP_442154.1_1 Reverse -227 -245 1.59244 0.0831
NP_442154.1_1 Reverse -223 -241 -7.84733 0.148
NP_442154.1_1 Reverse -218 -236 -7.84733 0.148
NP_442154.1_1 Reverse -356 -374 -11.6822 0.215
NP_442154.1_1 Reverse -220 -238 -13.6489 0.217
NP_442154.1_1 Reverse -311 -329 -13.7472 0.217
NP_442154.1_1 Reverse -362 -380 -15.6155 0.222
NP_442154.1_1 Reverse -308 -326 -15.8121 0.225
NP_440261.1_5 Forward -327 -314 -10.9938 0.23
NP_440988.1_7 Reverse -351 -370 3.6377 0.198
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCCTTCCCCTGCTCCCCTGCAGCCTCAGCCCACGCCTCCACCGGCGGTGCGGTCTTCCCCCATGCCCGATGCCCCAGCGCCCCGACGACAGCCCACTACCACTCCCAGTGATCCTCCTATGAACGTGGCTCCGTCCCCTACCCGTTCTGCACCGGCGCCAGCCCCAACAGCCACCCCAACCCCGACTTCATCTCAACCTTCTTTGCCGAAAACGAAGGGAGAAATGTTGCTACAACAAAATCAGGCTCCTTCCATTGTGCCGCCCCAACCCAATGGCAATAATGGGGAAACAGAAGCAGAAGAAACCCAAAGCCAAGCTCCTGGCCTGAACAATAACAATGGTTTGCCGGGGCCCATCCAATCCAAAAAGTAGTTAATGGTGTAAACGAACAAGCAACC

CDS

ATGACGGATTTAGGACAGGCCGGGGAAAGTTTGGTGGCGGCCTGGCTTGAACAGCAGGGCGGAAAAATCCTGCAACAACGCTGGCGATCGCCGTGGGGAGAAATTGACTTAATTACCCATTTTCCGGACACCAAAATTATCGCCTTTGTGGAGGTAAAAACCCGTAGCGGCGGCAATTGGGACCAGGGGGGATTGTTGGCGGTCAACGCCCGTAAGCAGGAAAAAATCTGGCAAACAGCCAACCATTTCCTTGCTAGTCAGCCCCAGTGGAGTGATTGGAACTGTCGTTTCGATGTGATGATCGTTTTTTCCCAGGGTTCCGTTCCTACAGGGGAGAATGCCGAGGGGAAGTTTGCTAATTTACCGACCAATTTCCAGATGGGCCAAACCATTGTCTGGCAAGGTTACCGCCTGCGGTTGGAGCAATATTTAACCGATGCTTTTGGAGGCTAG

Protein

MTDLGQAGESLVAAWLEQQGGKILQQRWRSPWGEIDLITHFPDTKIIAFVEVKTRSGGNWDQGGLLAVNARKQEKIWQTANHFLASQPQWSDWNCRFDVMIVFSQGSVPTGENAEGKFANLPTNFQMGQTIVWQGYRLRLEQYLTDAFGG