Your browser is old and dusty. Try Google Chrome!

Details for sll0188

ORF sll0188
Accession NP_442339.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -75 -89 0.589577 0.205
NP_441061.1_2 Reverse -263 -277 -2.16369 0.285
NP_440557.1_1 Reverse -257 -276 3.83436 0.193
NP_442761.1_9 Reverse -350 -369 13.7658 0.191
NP_441418.1_6 Reverse -313 -332 -19.7651 0.0955
NP_441418.1_6 Forward -112 -93 -29.1065 0.216
NP_441418.1_6 Forward -83 -64 -29.7948 0.238
NP_441418.1_6 Forward -385 -366 -30.1882 0.262
NP_442291.1_5 Forward -186 -170 -0.924775 0.19
NP_441453.1_4 Forward -83 -75 14.8674 0.00947
NP_441453.1_4 Reverse -74 -82 6.80426 0.121
NP_441623.1_1 Reverse -88 -106 0.412472 0.226
NP_441818.1_9 Reverse -310 -329 -6.58872 0.264
NP_441818.1_9 Reverse -19 -38 -10.9153 0.299
NP_440226.1_1 Forward -83 -64 5.99764 0.139
NP_441630.1_3 Reverse -66 -85 2.26107 0.231
NP_440813.1_1 Forward -89 -75 17.0102 0.223
NP_440120.1_4 Reverse -1 -15 13.3726 0.29
NP_440150.1_2 Forward -107 -88 6.29183 0.261
NP_442287.1_1 Reverse -102 -112 13.4509 0.277
NP_442173.1_1 Reverse -75 -83 13.8841 0.0225
NP_442173.1_1 Forward -82 -74 12.0158 0.0316
NP_442752.1_4 Reverse -74 -81 13.8055 0.0199
NP_442752.1_4 Forward -112 -105 12.1338 0.0546
NP_442752.1_4 Forward -172 -165 8.20058 0.127
NP_442752.1_4 Reverse -325 -332 5.64398 0.176
NP_443027.1_4 Forward -187 -177 10.9931 0.109
NP_443027.1_4 Forward -85 -75 6.46988 0.275
NP_441812.1_3 Reverse -73 -87 8.55439 0.251
NP_442975.1_10 Reverse -93 -107 5.01387 0.234
NP_442975.1_10 Forward -87 -73 3.44058 0.259
NP_440784.1_7 Reverse -75 -82 6.23397 0.241
NP_440784.1_7 Forward -82 -75 6.13563 0.241
NP_442861.1_1 Reverse -298 -317 15.4374 0.227
NP_441054.1_2 Reverse -328 -347 12.9791 0.212
NP_439979.1_7 Reverse -103 -120 15.2801 0.267
NP_442062.1_8 Reverse -74 -84 9.7148 0.0559
NP_442062.1_8 Forward -83 -73 5.09324 0.184
NP_442062.1_8 Forward -185 -175 4.79825 0.198
NP_441859.1_3 Reverse -343 -362 2.26028 0.263
NP_440304.1_4 Forward -159 -149 5.68323 0.196
NP_440304.1_4 Forward -267 -257 5.5849 0.201
NP_442242.1_4 Reverse -177 -184 9.77388 0.213
NP_440044.1_8 Forward -333 -314 1.37609 0.175
NP_440908.1_5 Reverse -286 -303 9.77361 0.255
NP_440916.1_1 Forward -292 -278 18.6825 0.0753
NP_439918.1_2 Reverse -269 -288 -5.01543 0.295
NP_441200.1_6 Forward -298 -281 9.38028 0.291
NP_441619.1_9 Reverse -326 -345 6.88262 0.203
NP_441208.1_9 Forward -26 -12 4.81781 0.285
NP_440300.1_1 Forward -89 -70 14.4533 0.113
NP_441925.1_4 Reverse -96 -115 -7.96609 0.203
NP_441925.1_4 Forward -344 -325 -8.06442 0.203
NP_441925.1_4 Forward -335 -316 -15.2425 0.263
NP_440856.1_4 Forward -286 -267 -3.24547 0.229
NP_441083.1_5 Forward -83 -73 9.81313 0.0224
NP_441083.1_5 Reverse -74 -84 -1.00328 0.289
NP_441738.1_2 Forward -81 -74 15.28 0.0102
NP_441738.1_2 Reverse -178 -185 13.3134 0.0335
NP_441558.1_5 Forward -85 -66 11.0125 0.0879
NP_440209.1_1 Reverse -74 -82 8.57422 0.0425
NP_442889.1_8 Forward -86 -72 10.0287 0.0916
NP_442889.1_8 Forward -188 -174 7.17714 0.16
NP_442889.1_8 Reverse -160 -174 3.63724 0.273
NP_440056.1_1 Forward -271 -252 7.47261 0.297
NP_439953.1_2 Reverse -376 -394 7.59063 0.27
NP_441792.1_1 Forward -360 -341 5.11266 0.281
NP_440343.1_9 Forward -122 -103 7.57094 0.278
NP_440906.1_5 Reverse -75 -82 6.23397 0.234
NP_440906.1_5 Forward -82 -75 6.13563 0.241
NP_440012.1_6 Reverse -245 -264 7.57094 0.247
NP_440747.1_10 Reverse -71 -83 -4.68091 0.115
NP_441486.1_1 Forward -86 -72 11.406 0.0164
NP_441486.1_1 Reverse -71 -85 2.5562 0.0812
NP_441486.1_1 Forward -188 -174 1.37622 0.112
NP_441486.1_1 Reverse -173 -187 -1.18038 0.169
NP_442850.1_8 Reverse -271 -290 12.7278 0.28
NP_439964.1_1 Forward -51 -32 11.7008 0.183
NP_440403.1_10 Forward -106 -87 7.07928 0.211
NP_442848.1_5 Reverse -100 -118 1.69077 0.276
NP_442848.1_5 Forward -296 -278 -1.65248 0.276
NP_442848.1_9 Reverse -88 -107 0.982764 0.265
NP_442848.1_9 Reverse -306 -325 0.0977854 0.276
NP_441012.1_4 Forward -269 -256 12.704 0.237
NP_441012.1_4 Forward -32 -19 5.82081 0.29
NP_443018.1_3 Forward -82 -75 11.7405 0.0655
NP_443018.1_3 Reverse -75 -82 5.44732 0.193
NP_440376.1_1 Reverse -81 -90 6.09625 0.111
NP_440376.1_1 Reverse -74 -83 5.89959 0.116
NP_440376.1_1 Forward -112 -103 0.196389 0.283
NP_440376.1_1 Forward -83 -74 -0.0986038 0.285
NP_441588.1_4 Forward -81 -71 15.9097 0.0369
NP_441588.1_4 Reverse -388 -398 11.0914 0.14
NP_442687.1_7 Reverse -73 -83 5.68323 0.189
NP_441846.1_10 Forward -116 -97 -20.7484 0.256
NP_442088.1_9 Forward -37 -18 21.6323 0.053
NP_442958.1_3 Forward -123 -104 -2.36049 0.293
NP_440533.1_6 Reverse -265 -284 10.3242 0.274
NP_441950.1_7 Reverse -245 -264 -0.4922 0.191
NP_442296.1_5 Forward -343 -324 -0.39387 0.299
NP_442658.1_1 Forward -85 -75 5.38779 0.269
NP_442782.1_2 Forward -76 -62 4.62115 0.251
NP_442496.1_5 Forward -111 -93 10.8356 0.217
NP_440669.1_7 Reverse -112 -130 22.5369 0.0366
NP_439959.1_3 Reverse -313 -332 14.5524 0.215
NP_442321.1_1 Reverse -308 -327 -4.03212 0.214
NP_441958.1_5 Reverse -73 -83 8.73149 0.0255
NP_440651.1_1 Reverse -16 -35 10.5209 0.231
NP_441127.1_1 Reverse -4 -18 9.73436 0.268
NP_440203.1_5 Reverse -259 -269 15.8108 0.0611
NP_440203.1_5 Reverse -106 -116 9.321 0.263
NP_439905.1_1 Reverse -104 -117 8.08242 0.238
NP_443001.1_7 Forward -184 -165 8.84924 0.199
NP_440984.1_7 Forward -117 -103 9.04604 0.131
NP_441097.1_2 Forward -121 -104 7.61033 0.242
NP_441580.1_6 Reverse -165 -184 -8.85033 0.275
NP_440858.1_1 Reverse -3 -22 0.392778 0.212
NP_442536.1_4 Forward -297 -279 6.41066 0.3
NP_443055.1_3 Forward -385 -366 15.4197 0.096
NP_443055.1_6 Reverse -95 -113 5.03327 0.181
NP_440602.1_8 Reverse -74 -88 11.0127 0.247
NP_442210.1_9 Reverse -252 -270 10.7372 0.237
NP_442853.1_5 Forward -32 -13 6.29183 0.287
NP_441099.1_5 Reverse -104 -123 -7.17871 0.171
NP_442002.1_1 Reverse -266 -284 -6.56903 0.249
NP_442002.1_1 Reverse -335 -353 -6.66736 0.249
NP_442002.1_9 Forward -186 -179 10.7572 0.185
NP_441294.1_7 Reverse -77 -91 10.3065 0.197
NP_440411.1_10 Reverse -254 -273 8.8954 0.293
NP_442438.1_10 Reverse -171 -185 3.14618 0.166
NP_442438.1_10 Forward -88 -74 -0.885388 0.283
NP_442431.1_10 Forward -115 -97 9.26226 0.134
NP_441110.1_1 Forward -115 -96 2.26107 0.297
NP_441674.1_10 Forward -105 -87 15.0638 0.0782
NP_440147.1_4 Reverse -72 -85 6.21414 0.0999
NP_441550.1_8 Reverse -72 -82 13.3526 0.0252
NP_441916.1_7 Reverse -74 -84 6.66654 0.0875
NP_441916.1_7 Reverse -176 -186 6.17489 0.105
NP_441916.1_7 Forward -83 -73 1.35667 0.286
NP_441916.1_10 Forward -273 -254 0.0977854 0.292
NP_441041.1_4 Forward -83 -64 -2.45882 0.112
NP_441041.1_4 Reverse -245 -264 -11.8003 0.252
NP_442004.1_6 Forward -391 -377 4.42448 0.215
NP_440703.1_9 Forward -96 -83 13.785 0.187
NP_441725.1_5 Reverse -257 -267 7.05986 0.106
NP_439966.1_4 Forward -307 -288 7.86593 0.207
NP_439966.1_7 Forward -85 -75 9.22267 0.119
NP_439966.1_7 Reverse -101 -111 8.3377 0.14
NP_442941.1_3 Forward -82 -72 1.25834 0.15
NP_442941.1_3 Reverse -75 -85 -0.806614 0.269
NP_440289.1_2 Forward -86 -73 2.57589 0.0936
NP_440260.1_8 Reverse -247 -265 6.41066 0.154
NP_442281.1_1 Forward -88 -74 17.9935 0.00513
NP_442281.1_1 Forward -190 -176 2.06395 0.278
NP_442281.1_1 Forward -270 -256 1.5723 0.296
NP_440437.1_1 Forward -340 -321 -1.47551 0.203
NP_442012.1_1 Reverse -376 -395 -1.08219 0.274
NP_441087.1_5 Forward -41 -22 1.86696 0.257
NP_441087.1_6 Forward -286 -268 -2.14486 0.284
NP_441457.1_2 Reverse -96 -115 9.3409 0.3
NP_441556.1_4 Reverse -367 -386 13.0901 0.201
NP_442982.1_5 Forward -100 -81 0.196116 0.246
NP_441644.1_6 Forward -83 -73 14.7292 0.0105
NP_441644.1_6 Reverse -103 -113 4.69947 0.228
NP_443049.1_6 Reverse -343 -353 15.447 0.114
NP_443049.1_6 Forward -113 -103 12.1289 0.24
NP_442215.1_2 Reverse -254 -270 13.6282 0.0225
NP_442215.1_2 Reverse -79 -95 6.35172 0.0719
NP_442215.1_2 Reverse -72 -88 -5.448 0.25
NP_442029.1_6 Reverse -69 -88 3.93269 0.274
NP_442029.1_6 Reverse -251 -270 3.53937 0.282
NP_442029.1_6 Reverse -339 -358 3.34271 0.282
NP_440929.1_8 Forward -83 -74 7.17789 0.0713
NP_442933.1_10 Forward -83 -74 8.06287 0.0885
NP_442933.1_10 Reverse -74 -83 7.96454 0.0937
NP_442933.1_10 Reverse -176 -185 5.50626 0.181
NP_442926.1_1 Reverse -19 -38 -5.9004 0.278
NP_442926.1_5 Reverse -69 -88 11.0468 0.221
NP_442554.1_4 Forward -302 -283 15.6341 0.122
NP_442554.1_8 Forward -82 -72 5.48657 0.146
NP_442554.1_8 Reverse -263 -273 2.92996 0.249
NP_442554.1_8 Reverse -75 -85 1.84832 0.292
NP_441762.1_7 Forward -84 -72 1.51394 0.0747
NP_442292.1_1 Forward -82 -73 8.65285 0.0335
NP_442292.1_5 Forward -321 -302 -2.0655 0.277
NP_441711.1_4 Reverse -65 -84 3.6377 0.238
NP_443009.1_5 Reverse -73 -84 7.53132 0.126
NP_442301.1_2 Reverse -93 -112 5.01354 0.269
NP_441715.1_4 Reverse -75 -85 5.28991 0.216
NP_441715.1_4 Reverse -177 -187 5.19158 0.224
NP_441715.1_9 Forward -271 -257 18.2892 0.261
NP_440881.1_5 Forward -114 -95 13.0775 0.299
NP_440279.1_2 Reverse -251 -270 15.5357 0.0657
NP_441448.1_1 Forward -312 -293 3.83436 0.287
NP_441198.1_5 Forward -81 -68 14.67 0.206
NP_440379.1_5 Reverse -154 -173 -11.5053 0.297
NP_440464.1_10 Forward -352 -342 14.345 0.169
NP_441468.1_1 Reverse -75 -82 6.13563 0.209
NP_441468.1_1 Forward -82 -75 6.0373 0.223
NP_441020.2_6 Reverse -282 -299 8.49531 0.197
NP_441015.1_10 Forward -117 -98 -3.44213 0.189
NP_441015.1_10 Reverse -320 -339 -11.0136 0.29
NP_441673.1_1 Forward -83 -74 1.27803 0.155
NP_441673.1_1 Reverse -74 -83 1.27803 0.155
NP_441956.1_1 Reverse -342 -361 16.6867 0.271
NP_441826.1_2 Reverse -170 -184 -3.44199 0.285
NP_441826.1_2 Forward -271 -257 -4.03198 0.291
NP_441826.1_2 Forward -96 -82 -4.03198 0.291
NP_441826.1_5 Forward -109 -90 1.76941 0.286
NP_441637.1_9 Reverse -192 -210 -1.16082 0.292
NP_442490.1_10 Forward -387 -369 8.7706 0.262
NP_441764.1_8 Reverse -123 -133 12.7463 0.284
NP_442868.1_6 Reverse -72 -82 0.0783647 0.248
NP_442719.1_2 Reverse -286 -304 2.08335 0.162
NP_442719.1_2 Reverse -88 -106 -5.97975 0.224
NP_442719.1_2 Forward -21 -3 -10.6996 0.28
NP_442677.1_7 Forward -32 -22 18.2696 0.237
NP_441612.1_2 Forward -208 -198 8.25885 0.228
NP_442227.1_2 Reverse -96 -115 -2.26216 0.272
NP_442361.1_3 Reverse -68 -81 9.36073 0.276
NP_440789.1_8 Reverse -344 -363 15.7324 0.197
NP_442808.1_1 Forward -84 -74 10.501 0.0481
NP_442808.1_1 Reverse -102 -112 4.50281 0.197
NP_441101.1_10 Reverse -90 -109 -1.27885 0.199
NP_440145.1_3 Reverse -246 -265 -4.03212 0.217
NP_440145.1_4 Reverse -104 -114 16.7941 0.109
NP_442542.1_2 Forward -105 -92 6.50913 0.222
NP_442050.1_5 Reverse -174 -184 9.02601 0.202
NP_442342.1_9 Reverse -146 -162 5.27008 0.241
NP_441493.2_7 Forward -39 -20 13.6675 0.216
NP_441114.1_3 Forward -390 -381 6.29291 0.285
NP_440558.1_2 Forward -269 -250 -5.11376 0.253
NP_440558.1_2 Forward -395 -376 -5.21209 0.254
NP_441878.1_6 Forward -104 -94 -6.50981 0.191
NP_441878.1_6 Forward -266 -256 -7.49312 0.231
NP_441036.1_8 Forward -84 -74 8.1415 0.176
NP_441557.1_5 Reverse -74 -83 8.94785 0.0289
NP_441557.1_5 Forward -83 -74 0.688044 0.128
NP_441557.1_5 Forward -185 -176 -0.885252 0.26
NP_441445.1_1 Reverse -316 -335 2.3594 0.235
NP_441590.1_4 Forward -345 -326 8.55343 0.249
NP_440084.1_3 Reverse -78 -97 13.6675 0.292
NP_441308.1_8 Forward -114 -104 9.51814 0.226
NP_441458.1_8 Reverse -187 -206 9.98091 0.229
NP_440058.1_7 Reverse -251 -270 18.1907 0.0646
NP_441549.1_9 Reverse -321 -339 -10.3056 0.274
NP_442347.1_2 Forward -82 -73 10.3245 0.058
NP_442347.1_2 Forward -352 -343 7.96454 0.122
NP_442347.1_2 Reverse -177 -186 3.93297 0.284
NP_442888.1_6 Forward -202 -183 4.71934 0.228
NP_442594.1_8 Reverse -266 -285 4.42435 0.264
NP_440136.1_2 Reverse -75 -82 6.23397 0.171
NP_440136.1_2 Forward -82 -75 6.13563 0.193
NP_442590.1_10 Forward -83 -64 3.53937 0.29
NP_442998.1_5 Reverse -13 -23 7.74818 0.284
NP_442998.1_10 Forward -81 -74 15.5754 0.0102
NP_442998.1_10 Reverse -178 -185 12.3305 0.0564
NP_442998.1_10 Reverse -150 -157 9.28223 0.117
NP_440899.1_1 Reverse -251 -270 8.30985 0.231
NP_440299.1_1 Reverse -70 -83 13.2934 0.0319
NP_440299.1_1 Forward -189 -176 5.32859 0.18
NP_441799.1_1 Forward -87 -73 6.29216 0.176
NP_441799.1_9 Forward -335 -316 3.53937 0.213
NP_441007.1_10 Forward -117 -104 0.510939 0.226
NP_440256.1_1 Reverse -364 -383 -8.35868 0.259
NP_440256.1_1 Reverse -259 -278 -9.53865 0.281
NP_440087.1_1 Forward -115 -96 -6.98204 0.263
NP_441296.1_7 Reverse -83 -102 13.0775 0.282
NP_442785.1_2 Forward -321 -302 21.2389 0.0489
NP_442069.1_7 Reverse -101 -120 18.0915 0.201
NP_442866.1_1 Reverse -251 -270 2.0644 0.158
NP_442993.1_1 Reverse -74 -90 19.4297 0.00378
NP_442386.1_9 Forward -84 -75 12.8806 0.0501
NP_442386.1_9 Reverse -102 -111 7.76745 0.217
NP_442386.1_10 Reverse -275 -288 4.54251 0.262
NP_441340.1_5 Reverse -75 -82 13.5105 0.0314
NP_441340.1_5 Forward -82 -75 5.84064 0.208
NP_442484.1_2 Reverse -63 -82 6.58763 0.156
NP_440059.1_4 Forward -178 -159 14.8474 0.272
NP_442506.1_9 Reverse -251 -270 9.93088 0.229
NP_441134.1_10 Forward -379 -361 13.3922 0.221
NP_440586.1_8 Forward -82 -75 9.47853 0.146
NP_440586.1_8 Reverse -75 -82 5.74197 0.283
NP_442251.1_6 Reverse -177 -184 9.77388 0.162
NP_442251.1_6 Reverse -149 -156 6.43063 0.298
NP_442959.1_4 Reverse -296 -315 6.88262 0.224
NP_440684.1_9 Forward -362 -348 9.34103 0.221
NP_441262.1_3 Reverse -74 -81 14.7888 0.0223
NP_440027.1_8 Reverse -253 -272 5.89851 0.279
NP_443051.1_1 Reverse -73 -82 7.47288 0.0571
NP_439984.1_7 Reverse -99 -117 -3.81576 0.271
NP_439937.1_4 Forward -103 -84 9.73422 0.278
NP_440372.1_2 Reverse -75 -82 13.8055 0.0214
NP_440372.1_2 Forward -82 -75 6.52896 0.188
NP_441138.1_5 Reverse -193 -206 3.02202 0.297
NP_440574.1_3 Forward -190 -171 2.55606 0.173
NP_441181.1_9 Reverse -21 -39 12.7038 0.113
NP_441789.1_7 Forward -285 -266 -1.08295 0.251
NP_440316.1_10 Forward -113 -103 6.07655 0.271
NP_441803.1_2 Reverse -263 -282 1.37609 0.232
NP_441572.1_1 Reverse -299 -318 -3.73712 0.214
NP_441572.1_7 Reverse -108 -127 3.44104 0.117
NP_441572.1_7 Forward -271 -252 -4.32711 0.232
NP_442384.1_10 Forward -83 -70 14.0806 0.0169
NP_442384.1_10 Reverse -347 -360 1.9859 0.24
NP_442339.1_1 Forward -167 -148 17.3048 0.133
NP_442339.1_2 Forward -307 -288 26.2538 0.00165
NP_442339.1_3 Forward -190 -172 15.3588 0.157
NP_442339.1_4 Forward -77 -58 25.6638 0.00109
NP_442339.1_7 Forward -219 -202 19.705 0.291
NP_442339.1_8 Forward -377 -360 16.9518 0.292
NP_441877.1_5 Reverse -292 -311 -0.39387 0.276
NP_441018.1_7 Reverse -70 -89 7.17762 0.276
NP_442262.1_10 Forward -82 -75 13.2155 0.0213
NP_442262.1_10 Reverse -115 -122 8.49558 0.226
NP_441689.1_5 Reverse -174 -184 12.4676 0.132
NP_441689.1_5 Forward -85 -75 8.53436 0.132
NP_442244.1_7 Forward -124 -105 12.8808 0.216
NP_440531.1_6 Forward -91 -72 -3.44213 0.266
NP_441060.1_3 Reverse -319 -338 7.86593 0.267
NP_440297.1_9 Reverse -257 -267 6.96153 0.161
NP_442187.1_3 Reverse -324 -334 15.5163 0.119
NP_442280.1_10 Reverse -253 -271 7.40243 0.268
NP_441103.1_2 Reverse -63 -81 10.7364 0.156
NP_440894.1_10 Reverse -76 -95 2.0644 0.298
NP_440999.1_9 Forward -87 -73 1.57289 0.162
NP_440888.1_2 Reverse -103 -117 9.93039 0.11
NP_440888.1_2 Forward -83 -69 9.53707 0.123
NP_440491.1_1 Forward -86 -67 10.0356 0.202
NP_441543.1_2 Forward -82 -73 7.07956 0.131
NP_441543.1_2 Reverse -75 -84 6.09625 0.153
NP_441543.1_2 Forward -89 -80 4.42462 0.246
NP_442845.1_2 Reverse -81 -95 15.1426 0.0752
NP_442845.1_2 Forward -118 -104 13.9626 0.088
NP_442845.1_2 Reverse -68 -82 6.58777 0.207
NP_441178.1_6 Forward -329 -310 4.03023 0.269
NP_441319.1_8 Forward -337 -319 5.62401 0.277
NP_441469.1_8 Forward -266 -257 6.39124 0.227
NP_442337.1_8 Forward -122 -103 -1.08219 0.278
NP_442578.1_7 Reverse -75 -82 6.0373 0.18
NP_442578.1_7 Forward -184 -177 5.25066 0.251
NP_441462.1_2 Reverse -74 -84 8.82982 0.03
NP_443062.1_6 Reverse -218 -237 4.52268 0.217
NP_441601.1_4 Forward -335 -316 -3.3438 0.293
NP_440519.1_6 Reverse -251 -265 10.0294 0.29
NP_442204.1_5 Reverse -71 -90 2.0644 0.22
NP_441560.1_4 Reverse -332 -351 20.944 0.217
NP_440516.1_8 Reverse -74 -83 9.4395 0.0183
NP_440516.1_8 Forward -83 -74 5.11294 0.118
NP_440516.1_8 Forward -112 -103 -0.491928 0.262
NP_441785.1_1 Reverse -250 -264 11.3809 0.3
NP_442428.1_5 Reverse -75 -82 6.13563 0.209
NP_442428.1_5 Forward -82 -75 6.0373 0.212
NP_440783.1_3 Reverse -283 -302 1.17943 0.266
NP_440783.1_5 Forward -122 -103 -3.44213 0.275
NP_441867.1_2 Forward -113 -94 -17.1101 0.291
NP_440673.1_3 Forward -81 -74 12.4288 0.0426
NP_440673.1_3 Reverse -258 -265 6.72562 0.277
NP_440673.1_7 Reverse -165 -184 10.3242 0.111
NP_440673.1_7 Forward -94 -75 6.98095 0.15
NP_441052.1_2 Forward -353 -343 3.51995 0.18
NP_441052.1_2 Forward -83 -73 1.65166 0.233
NP_441052.1_2 Forward -334 -324 -0.609952 0.288
NP_442219.1_8 Reverse -246 -265 9.03681 0.234
NP_442219.1_8 Forward -363 -344 7.29741 0.271
NP_442219.1_9 Forward -82 -73 7.96454 0.0696
NP_440436.1_4 Forward -82 -73 7.57079 0.124
NP_440436.1_4 Reverse -75 -84 7.37413 0.132
NP_441884.1_9 Forward -188 -169 -21.3384 0.242
NP_441884.1_9 Forward -115 -96 -22.6167 0.281
NP_441884.1_9 Forward -86 -67 -23.4033 0.284
NP_441884.1_9 Reverse -227 -246 -23.7966 0.284
NP_441719.1_4 Reverse -75 -82 6.82395 0.0855
NP_441719.1_4 Forward -82 -75 6.52896 0.188
NP_441733.1_10 Reverse -71 -84 6.80412 0.171
NP_441004.1_1 Forward -109 -90 -15.5368 0.275
NP_442366.1_3 Forward -186 -168 -4.79907 0.276
NP_442366.1_3 Reverse -175 -193 -4.8974 0.278
NP_442366.1_3 Forward -84 -66 -5.38906 0.287
NP_442366.1_5 Reverse -71 -81 15.4175 0.0374
NP_442366.1_5 Forward -388 -378 9.91099 0.298
NP_442873.1_9 Reverse -93 -112 7.66846 0.236
NP_440296.1_10 Forward -115 -96 -8.16202 0.248
NP_442206.1_1 Reverse -94 -113 -3.24547 0.166
NP_442206.1_10 Reverse -377 -392 -0.0201027 0.279
NP_443054.1_2 Forward -92 -78 2.65453 0.242
NP_440508.1_4 Forward -103 -84 15.1424 0.229
NP_441851.1_10 Reverse -73 -83 7.35486 0.142
NP_440611.1_8 Forward -99 -80 12.7825 0.195
NP_442011.1_1 Forward -332 -313 -0.0988766 0.268
NP_442515.1_1 Forward -209 -195 -3.73699 0.297
NP_440593.1_3 Reverse -90 -109 -7.27704 0.291
NP_440588.1_2 Reverse -72 -91 -0.4922 0.15
NP_440588.1_2 Forward -99 -80 -3.83545 0.197
NP_439950.1_1 Forward -211 -202 14.7494 0.195
NP_440195.1_4 Forward -95 -76 13.4708 0.127
NP_442006.1_2 Forward -112 -95 -17.6607 0.279
NP_441570.1_1 Forward -185 -167 -17.3854 0.273
NP_441078.1_4 Reverse -74 -83 0.0980582 0.205
NP_441078.1_4 Forward -83 -74 0.0980582 0.205
NP_441078.1_4 Forward -90 -81 -0.885252 0.209
NP_440539.1_9 Forward -247 -228 -4.22878 0.286
NP_441539.1_10 Forward -121 -102 -0.39387 0.171
NP_441663.1_8 Reverse -208 -227 -3.54046 0.291
NP_442348.1_2 Forward -25 -16 13.2744 0.198
NP_440707.1_9 Reverse -329 -348 -0.000545616 0.293
NP_442443.1_1 Reverse -314 -333 -5.01543 0.28
NP_441432.1_8 Reverse -73 -82 14.0611 0.0258
NP_441432.1_8 Forward -266 -257 3.53964 0.244
NP_442320.1_8 Forward -89 -75 -5.40861 0.225
NP_442320.1_8 Reverse -68 -82 -5.50694 0.228
NP_442157.1_9 Forward -284 -265 18.4857 0.15
NP_441945.1_10 Forward -128 -109 7.47261 0.284
NP_442510.1_5 Reverse -105 -124 16.3224 0.171
NP_442010.1_9 Reverse -284 -298 12.487 0.197
NP_442489.1_7 Forward -83 -74 0.786375 0.152
NP_442489.1_7 Reverse -74 -83 0.589713 0.17
NP_442489.1_7 Reverse -176 -185 -2.16355 0.295
NP_440559.1_1 Forward -82 -73 7.76787 0.0918
NP_440559.1_1 Reverse -75 -84 6.09625 0.134
NP_440559.1_1 Forward -184 -175 4.62128 0.24
NP_441659.2_8 Forward -83 -73 12.7631 0.0147
NP_441659.2_8 Reverse -94 -104 1.16001 0.248
NP_441022.1_1 Forward -74 -65 10.7788 0.285
NP_441040.1_2 Reverse -72 -91 -11.6036 0.255
NP_440442.1_3 Reverse -375 -389 13.9626 0.298
NP_442346.1_5 Forward -266 -256 10.5998 0.0917
NP_442346.1_5 Reverse -73 -83 7.05986 0.183
NP_442346.1_5 Forward -396 -386 6.66654 0.195
NP_440545.1_3 Reverse -90 -107 0.432165 0.139
NP_440545.1_5 Forward -110 -93 4.16874 0.26
NP_441629.1_1 Forward -243 -224 7.86593 0.249
NP_441744.1_2 Forward -37 -18 15.3391 0.266
NP_440459.1_2 Reverse -254 -271 8.59364 0.254
NP_440459.1_2 Forward -85 -68 7.70866 0.283
NP_441653.1_2 Reverse -63 -82 3.14308 0.274
NP_441943.1_8 Reverse -85 -104 -12.9802 0.261
NP_442311.1_5 Forward -307 -288 1.57275 0.261
NP_442603.1_7 Forward -328 -314 6.29216 0.249
NP_442603.1_7 Forward -123 -109 6.29216 0.249
NP_442603.1_7 Forward -83 -69 6.19383 0.253
NP_441585.1_6 Forward -385 -366 13.5683 0.263
NP_441833.1_4 Forward -82 -75 6.52896 0.0924
NP_441833.1_4 Reverse -75 -82 6.23397 0.163
NP_442162.1_9 Forward -82 -75 12.9205 0.0282
NP_442162.1_9 Reverse -75 -82 12.9205 0.0282
NP_440671.1_4 Forward -89 -75 6.29277 0.252
NP_442140.1_3 Forward -82 -72 10.2065 0.0902
NP_442140.1_3 Reverse -115 -125 4.40493 0.243
NP_442021.1_3 Reverse -326 -345 -8.16202 0.296
NP_440875.1_9 Reverse -105 -115 7.00932 0.287
NP_441813.1_5 Forward -85 -75 13.2547 0.0178
NP_441813.1_7 Forward -37 -23 8.25877 0.293
NP_440590.1_4 Forward -82 -69 7.98409 0.0491
NP_440590.1_4 Reverse -377 -390 0.60927 0.148
NP_440590.1_4 Reverse -177 -190 -3.81562 0.255
NP_440567.1_1 Reverse -75 -89 3.44117 0.143
NP_440567.1_1 Forward -82 -68 2.16287 0.182
NP_440035.1_10 Forward -343 -325 16.1937 0.229
NP_442497.1_10 Forward -82 -73 0.589713 0.153
NP_442497.1_10 Reverse -75 -84 -1.18024 0.256
NP_440821.1_4 Forward -85 -75 0.471689 0.174
NP_440821.1_4 Reverse -72 -82 -0.314959 0.251
NP_440821.1_4 Forward -187 -177 -0.511621 0.269
NP_441239.1_9 Forward -85 -73 10.4621 0.0783
NP_441239.1_9 Reverse -161 -173 5.15219 0.227
NP_441239.1_9 Reverse -93 -105 3.57889 0.283
NP_441951.1_4 Reverse -68 -87 10.4225 0.228
NP_442568.1_1 Reverse -287 -306 2.85027 0.267
NP_440604.1_6 Reverse -332 -351 -2.85214 0.225
NP_442044.1_1 Forward -172 -153 -12.6852 0.273
NP_442270.1_9 Forward -270 -251 -11.3086 0.27
NP_442643.1_5 Forward -80 -61 -5.70374 0.293
NP_441017.1_6 Forward -161 -147 12.6836 0.217
NP_441017.1_6 Forward -189 -175 11.7987 0.242
NP_441017.1_6 Forward -275 -261 11.7003 0.247
NP_442216.1_4 Reverse -202 -210 8.08217 0.255
NP_440354.1_5 Reverse -253 -272 7.37428 0.174
NP_440354.1_7 Reverse -68 -86 10.2456 0.224
NP_440546.1_4 Reverse -74 -84 14.5061 0.0459
NP_440546.1_4 Forward -112 -102 8.30077 0.196
NP_440546.1_4 Reverse -87 -97 8.30077 0.196
NP_440546.1_4 Forward -83 -73 8.20381 0.199
NP_441230.1_6 Forward -311 -292 18.289 0.142
NP_440675.1_1 Reverse -253 -272 7.07928 0.195
NP_440462.1_6 Forward -85 -75 11.7798 0.0396
NP_440462.1_6 Forward -187 -177 2.33998 0.29
NP_442340.1_7 Reverse -14 -33 18.879 0.175
NP_441249.1_3 Forward -85 -66 0.884433 0.285
NP_441474.1_1 Forward -252 -233 1.86696 0.247
NP_442402.1_4 Forward -361 -342 -6.78612 0.266
NP_442402.1_4 Reverse -289 -308 -6.98278 0.268
NP_440036.1_2 Forward -184 -165 9.24257 0.285
NP_441848.1_4 Reverse -7 -23 7.74165 0.288
NP_440696.1_3 Reverse -144 -162 -2.24246 0.274
NP_441843.2_2 Forward -330 -311 12.9783 0.254
NP_442023.1_2 Forward -104 -85 6.68596 0.275
NP_442039.1_4 Reverse -75 -82 11.6422 0.0747
NP_442039.1_7 Forward -308 -298 15.3197 0.211
NP_441811.1_1 Reverse -154 -173 7.17762 0.28
NP_440753.1_5 Forward -24 -5 9.43923 0.24
NP_440825.1_7 Forward -82 -72 10.9578 0.278
NP_442837.1_3 Forward -82 -75 6.0373 0.25
NP_442837.1_3 Reverse -75 -82 6.0373 0.25
NP_440160.1_2 Reverse -82 -101 -3.63879 0.26
NP_442053.1_1 Forward -83 -74 7.17789 0.104
NP_440505.1_3 Reverse -323 -333 11.4848 0.0755
NP_440505.1_3 Reverse -72 -82 7.64985 0.151
NP_442360.1_5 Reverse -88 -98 13.4514 0.278
NP_441959.1_9 Forward -121 -102 17.5024 0.119
NP_441102.1_1 Reverse -75 -94 9.53756 0.154
NP_440520.1_1 Reverse -267 -286 -2.55715 0.208
NP_441203.1_1 Reverse -82 -101 -12.8819 0.146
NP_441203.1_2 Reverse -310 -329 -6.68705 0.267
NP_442532.1_1 Forward -206 -192 11.1826 0.23
NP_442532.1_7 Reverse -25 -39 1.47456 0.285
NP_441408.2_7 Forward -268 -249 -3.04881 0.272
NP_440914.1_1 Forward -83 -73 14.373 0.0158
NP_440914.1_1 Forward -112 -102 6.76087 0.267
NP_441011.1_8 Reverse -75 -84 14.651 0.023
NP_442533.1_1 Reverse -310 -329 -13.3736 0.237
NP_442533.1_1 Reverse -230 -249 -16.5201 0.271
NP_442533.1_1 Forward -115 -96 -16.9135 0.277
NP_442533.1_6 Forward -96 -87 8.84951 0.0714
NP_442533.1_6 Reverse -74 -83 5.40793 0.14
NP_442533.1_6 Forward -83 -74 4.52295 0.179
NP_442533.1_6 Reverse -103 -112 4.0313 0.194
NP_442533.1_6 Forward -265 -256 3.04799 0.228
NP_442533.1_6 Reverse -88 -97 1.57302 0.294
NP_442533.1_6 Forward -271 -262 1.57302 0.294
NP_443016.1_1 Reverse -97 -116 -7.96535 0.289
NP_442269.1_10 Reverse -326 -345 4.81767 0.241
NP_442202.1_10 Reverse -102 -116 3.44117 0.278
NP_440116.1_8 Reverse -75 -94 -5.80207 0.195
NP_441527.1_7 Forward -35 -16 6.98015 0.298
NP_442728.1_7 Forward -278 -264 11.996 0.289
NP_441106.1_1 Forward -84 -75 7.66954 0.0776
NP_440429.1_2 Forward -190 -171 9.63589 0.272
NP_442588.1_6 Reverse -233 -252 0.0977854 0.252
NP_441186.1_2 Forward -264 -245 17.994 0.185
NP_441286.1_1 Reverse -73 -85 -4.18925 0.152
NP_440670.1_8 Reverse -74 -83 8.65285 0.0627
NP_440670.1_8 Forward -83 -74 6.29291 0.124
NP_440886.1_7 Forward -84 -74 7.74772 0.0843
NP_440886.1_7 Reverse -102 -112 3.71617 0.267
NP_440828.1_1 Reverse -105 -124 6.48849 0.197
NP_442614.1_2 Reverse -325 -339 12.7826 0.145
NP_442614.1_2 Reverse -3 -17 9.63603 0.242
NP_442614.1_2 Reverse -74 -88 6.19444 0.291
NP_442072.1_9 Forward -91 -73 -22.4003 0.234
NP_442072.1_9 Reverse -73 -91 -23.3836 0.292
NP_442401.1_3 Reverse -307 -326 11.7008 0.296
NP_441753.1_10 Forward -121 -102 3.14605 0.221
NP_442022.1_4 Reverse -268 -287 7.07928 0.268
NP_440907.2_8 Reverse -104 -114 6.76441 0.15
NP_440907.2_8 Forward -82 -72 5.87944 0.184
NP_441021.1_1 Forward -82 -63 -9.53865 0.217
NP_440326.1_5 Reverse -254 -267 19.0955 0.179
NP_441626.1_2 Reverse -75 -82 12.2322 0.0511
NP_441626.1_2 Forward -82 -75 5.93897 0.231
NP_442794.1_1 Reverse -110 -122 15.1819 0.0544
NP_442794.1_1 Reverse -70 -82 9.38042 0.0795
NP_442615.1_1 Reverse -72 -90 -1.35749 0.128
NP_440387.1_1 Forward -83 -67 -5.25134 0.222
NP_441431.1_2 Forward -86 -72 7.47213 0.241
NP_441431.1_3 Reverse -307 -326 5.01433 0.263
NP_441488.1_8 Reverse -69 -83 10.6187 0.146
NP_441993.1_1 Forward -110 -91 3.79838 0.228
NP_441174.1_4 Reverse -342 -352 9.51814 0.298
NP_440467.1_3 Reverse -271 -290 11.5492 0.274
NP_440114.1_10 Reverse -74 -88 12.586 0.0783
NP_440737.1_1 Reverse -15 -34 5.99764 0.251
NP_441510.2_7 Forward -89 -75 10.6187 0.28
NP_441510.2_7 Forward -83 -69 9.43874 0.281
NP_440287.1_5 Forward -21 -2 10.2251 0.286
NP_440293.1_3 Reverse -319 -338 -6.39206 0.288
NP_440766.1_4 Reverse -172 -186 6.3911 0.103
NP_440766.1_4 Reverse -70 -84 4.52282 0.126
NP_439988.1_7 Reverse -80 -94 12.0937 0.292
NP_441246.1_6 Forward -178 -160 5.91901 0.281
NP_439910.1_2 Forward -91 -74 -21.594 0.183
NP_440502.1_3 Reverse -99 -109 15.2509 0.196
NP_442867.1_8 Forward -333 -314 12.1925 0.197
NP_442867.1_8 Reverse -369 -388 8.94757 0.23
NP_442867.1_8 Forward -252 -233 4.22769 0.287
NP_440457.1_1 Reverse -70 -82 0.530633 0.25
NP_442680.1_5 Forward -212 -193 7.20363 0.201
NP_442680.1_5 Forward -210 -191 1.3422 0.243
NP_441984.1_3 Forward -87 -69 5.13236 0.295
NP_442509.1_9 Forward -44 -34 7.0594 0.24
NP_442514.1_5 Forward -279 -260 -9.24438 0.295
NP_440554.1_4 Reverse -75 -85 6.96153 0.107
NP_440554.1_4 Reverse -177 -187 1.74999 0.29
NP_441885.1_5 Reverse -74 -84 7.94484 0.0385
NP_441885.1_5 Forward -83 -73 1.35667 0.11
NP_441885.1_5 Forward -185 -175 0.668351 0.133
NP_442341.1_7 Forward -84 -70 7.66941 0.0994
NP_442341.1_7 Reverse -73 -87 2.75286 0.247
NP_442341.1_7 Reverse -175 -189 2.35953 0.259
NP_441173.1_9 Reverse -298 -306 13.2937 0.17
NP_441173.1_9 Reverse -289 -297 9.75379 0.284
NP_442534.1_7 Reverse -80 -99 9.43923 0.224
NP_440423.1_10 Reverse -67 -86 9.83255 0.259
NP_443000.1_7 Reverse -72 -82 0.57002 0.294
NP_440076.1_3 Forward -101 -82 19.764 0.274
NP_441842.1_10 Reverse -67 -81 7.17775 0.264
NP_440275.1_3 Reverse -72 -82 5.48657 0.145
NP_440091.1_1 Reverse -382 -394 7.21714 0.0852
NP_440091.1_1 Forward -87 -75 3.57889 0.155
NP_443060.1_5 Reverse -248 -267 10.1267 0.189
NP_442275.1_1 Forward -304 -285 2.0644 0.284
NP_440679.1_5 Forward -350 -331 8.65258 0.292
NP_442451.1_2 Reverse -168 -187 -7.67036 0.237
NP_440258.1_7 Reverse -191 -210 11.7928 0.287
NP_439962.1_4 Reverse -328 -347 -6.58872 0.283
NP_439962.1_4 Forward -335 -316 -8.45701 0.294
NP_439962.1_6 Reverse -18 -36 13.7855 0.194
NP_442495.1_4 Reverse -274 -284 16.7946 0.0771
NP_442495.1_4 Forward -113 -103 14.533 0.16
NP_440149.1_8 Forward -83 -64 -8.06369 0.298
NP_440216.1_1 Reverse -74 -88 -11.3085 0.178
NP_440216.1_1 Forward -90 -76 -11.5051 0.192
NP_440216.1_9 Forward -308 -299 7.57121 0.286
NP_440172.1_1 Forward -265 -255 8.4365 0.0621
NP_440172.1_1 Forward -185 -175 5.68323 0.136
NP_440172.1_1 Forward -157 -147 2.43831 0.279
NP_440172.1_1 Forward -83 -73 2.33998 0.279
NP_442015.1_10 Forward -94 -81 4.54251 0.167
NP_442015.1_10 Forward -380 -367 1.19926 0.21
NP_441045.1_4 Forward -307 -288 16.3224 0.268
NP_441226.1_7 Reverse -75 -82 12.7234 0.0312
NP_441226.1_7 Forward -82 -75 11.5435 0.0757
NP_441226.1_7 Reverse -104 -111 8.29857 0.205
NP_441485.1_9 Reverse -266 -285 16.7157 0.283
NP_441111.1_7 Forward -82 -74 8.86921 0.0589
NP_441766.1_2 Reverse -74 -83 8.1612 0.0645
NP_441766.1_2 Forward -83 -74 5.89959 0.103
NP_441766.1_2 Forward -185 -176 4.32629 0.187
NP_442417.1_5 Forward -83 -69 7.66941 0.18
NP_440416.1_9 Reverse -67 -86 -12.7836 0.16
NP_440416.1_9 Forward -130 -111 -18.1918 0.253
NP_443052.1_2 Forward -298 -279 19.3707 0.1
NP_443052.1_9 Reverse -99 -118 0.392778 0.2
NP_443052.1_9 Forward -332 -313 -1.96717 0.231
NP_443052.1_9 Forward -335 -316 -5.01543 0.265
NP_443052.1_9 Forward -38 -19 -5.99873 0.276
NP_440072.1_5 Forward -121 -103 -2.24246 0.269
NP_442154.1_1 Forward -111 -93 -15.9105 0.228
NP_442154.1_1 Reverse -269 -287 -16.9921 0.247
NP_440988.1_2 Forward -335 -317 7.09898 0.299
NP_440988.1_10 Reverse -101 -115 9.44903 0.204
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTAAGTCATCGTTGCCCACCCCGCTAATGGTCAGTTGGTCTCGGTCTTCATCCCCAAAGCGCTGCACGACCCCCACCTGGAGCAGCACATCCTTGGCAAAACTGGGTAAAGCTCCCCCAGCCACTAAGCCCAGGGCAATGACTAAGCCACCCACACGTTGGACAGCAACCTTCAGTAAGTTACGGGGGGGGGAAATAAACATAAATAATCAACGGCGATCTATATTGGCGAGGGAATCAAAGGCAATCTAGCATCCTAACCTATCATTTTTGCTCTGCCATCTGGAGGGGATGGGGACAGTGGCCCAGGGCTAACACCGATCGCCAAAGGGTTTGTGTTATTTTGAGGGAACTGTGTAAACGGCCTCCAGCACCGGCATTTTTCCTCACTTTGCCCTG

CDS

ATGGAGACTGGGACCGTCAAAGTTTTTCTGGATGGCGATCAACCTATGGCAATGGATTTACCCCTCAGGTTAAGCAATGCTCCCTCATTGGGCCAGGTTTTCACTCCGGTCAATGTGGCTATTTTGAGTTCCCTCGGCATCCATGGCTTTATTTTGGGCTTGGCTTTACCCCATTGGCAATGGCAAGAATCCGCTGGGGATAACCTGACAGACCGCAATCCCGTGGGAGTGATCGAATTAACTCCAGCAGAACAAAGTCGTTTACCAGAAACGGACATTTTTTCTAGCAGTGGCCTTTTTCCCACTGCCCCCAGTGGTAGTGACCCAGGTGCCATTCCCGCTGACCCAAATTTGCCCATTCCTCCTAGCGGCGACTACAACTATTCCTTGCCTTCGGGGCCGGGCATTATGCCACCGCCACCGGCCATGCCCAATTTACCGGCCTACCCCAATTTGCCCCCCCTGACTAGCTATGGCAATTTGAGCCGTTTACCCATCACTGGTCCCCCCATTCCTTCCCTACCCCGGTTCCCTTCCACCAGACAGATTCCCCGTCCCCCAGGCCTATTTGCTCCCACCCCAGACCAGGGCATGAATCCCCTGGGCCCCGGCCCCAACCGGCCTGATTTTGGACCCTTACCTCCTTCCCAGGGCACAGGCTTTATTACTAGGGCTCCCCAGGGCATTACTACTCCCCAGGAACCGGGTTTGAGGGCGGAGGGAGAAGACACTTCTCCAGAAAAGCTGCGGGAAAATACGCTGGTTTCCATTGCCCAGCAAGGCCAGGCTTTAAAAGCGAAGGACACCATTAGCGGCGCCTATCCCCCCATTGCCTGTCGTAATCGTACGGAAGCTACGGTGGTCTATAACGTTTTTCCCAGCGGTCAGAAAGATCTGGTGGGCCGCTCCCGCTATCCCATCTTCAATCAGCTAGCTGAACAGGCGATCGCCAACAGAACCTATGGTGAACCCACCCAGGTGACAGTTTCCTTTAAATATGATGCCGAGATTTGTGGTGGTGTGGATCAATTCATTCCCCCCGGTGGAGAAACCACCAATCCAGCAGTGCCGACTGTCCCTACGCCTTCCCAAGTTACCCCGGCCCCCACGATTAGCCCCGCCCCAGGCATAGCTCCTTCCCCTGCTCCCCTGCAGCCTCAGCCCACGCCTCCACCGGCGGTGCGGTCTTCCCCCATGCCCGATGCCCCAGCGCCCCGACGACAGCCCACTACCACTCCCAGTGATCCTCCTATGAACGTGGCTCCGTCCCCTACCCGTTCTGCACCGGCGCCAGCCCCAACAGCCACCCCAACCCCGACTTCATCTCAACCTTCTTTGCCGAAAACGAAGGGAGAAATGTTGCTACAACAAAATCAGGCTCCTTCCATTGTGCCGCCCCAACCCAATGGCAATAATGGGGAAACAGAAGCAGAAGAAACCCAAAGCCAAGCTCCTGGCCTGAACAATAACAATGGTTTGCCGGGGCCCATCCAATCCAAAAAGTAG

Protein

METGTVKVFLDGDQPMAMDLPLRLSNAPSLGQVFTPVNVAILSSLGIHGFILGLALPHWQWQESAGDNLTDRNPVGVIELTPAEQSRLPETDIFSSSGLFPTAPSGSDPGAIPADPNLPIPPSGDYNYSLPSGPGIMPPPPAMPNLPAYPNLPPLTSYGNLSRLPITGPPIPSLPRFPSTRQIPRPPGLFAPTPDQGMNPLGPGPNRPDFGPLPPSQGTGFITRAPQGITTPQEPGLRAEGEDTSPEKLRENTLVSIAQQGQALKAKDTISGAYPPIACRNRTEATVVYNVFPSGQKDLVGRSRYPIFNQLAEQAIANRTYGEPTQVTVSFKYDAEICGGVDQFIPPGGETTNPAVPTVPTPSQVTPAPTISPAPGIAPSPAPLQPQPTPPPAVRSSPMPDAPAPRRQPTTTPSDPPMNVAPSPTRSAPAPAPTATPTPTSSQPSLPKTKGEMLLQQNQAPSIVPPQPNGNNGETEAEETQSQAPGLNNNNGLPGPIQSKK