Your browser is old and dusty. Try Google Chrome!

Details for sll0182

ORF sll0182
Accession NP_442354.1
Symbol
Category ABC transporter ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440761.1_4 Forward -353 -334 -20.8467 0.3
NP_441434.1_1 Reverse -214 -228 14.4309 0.233
NP_441434.1_1 Forward -324 -310 8.31942 0.259
NP_440057.1_8 Forward -191 -172 18.289 0.204
NP_443018.1_3 Forward -373 -366 7.11894 0.16
NP_441077.1_6 Forward -123 -107 2.89827 0.276
NP_440642.1_10 Reverse -248 -262 6.48882 0.23
NP_442496.1_5 Reverse -357 -375 5.32902 0.288
NP_442205.1_9 Forward -191 -175 -1.21977 0.264
NP_442025.1_8 Reverse -365 -384 15.8307 0.193
NP_442690.1_1 Forward -163 -144 -11.5053 0.23
NP_441079.1_7 Forward -327 -308 -4.42619 0.25
NP_442933.1_6 Forward -342 -323 12.9387 0.287
NP_440158.1_1 Reverse -304 -323 12.9387 0.176
NP_441244.1_1 Forward -370 -352 18.0137 0.0942
NP_441876.1_2 Forward -339 -320 10.1275 0.268
NP_440334.1_1 Reverse -121 -140 15.517 0.262
NP_442528.1_10 Reverse -355 -374 17.8957 0.162
NP_442158.1_4 Reverse -247 -257 14.0414 0.203
NP_440733.1_2 Reverse -307 -325 13.1799 0.195
NP_440306.1_8 Reverse -239 -258 -0.787962 0.222
NP_441340.1_2 Reverse -355 -374 16.4673 0.277
NP_440146.1_1 Reverse -125 -143 15.8536 0.181
NP_442959.1_5 Reverse -234 -253 6.58763 0.251
NP_442959.1_5 Forward -117 -98 6.29264 0.261
NP_442887.1_5 Forward -388 -369 -5.70374 0.264
NP_441877.1_5 Forward -383 -364 15.1424 0.124
NP_442262.1_10 Forward -373 -366 8.20058 0.25
NP_442917.1_1 Forward -284 -265 11.11 0.181
NP_442280.1_10 Reverse -240 -258 5.35702 0.287
NP_440237.1_5 Reverse -252 -266 11.1104 0.269
NP_442710.1_7 Reverse -309 -328 -3.18613 0.262
NP_440220.1_4 Forward -387 -368 -3.44288 0.286
NP_440544.1_5 Reverse -265 -272 13.8024 0.28
NP_441668.1_4 Forward -383 -364 0.0977854 0.247
NP_442843.1_1 Reverse -366 -385 -3.3438 0.222
NP_441124.1_5 Forward -311 -301 13.3901 0.215
NP_441124.1_5 Reverse -209 -219 11.0983 0.267
NP_441124.1_5 Forward -384 -374 10.1434 0.297
NP_441432.1_9 Forward -112 -99 8.40445 0.289
NP_441968.1_1 Forward -256 -248 15.162 0.257
NP_440352.1_5 Forward -264 -245 10.125 0.278
NP_442311.1_5 Forward -272 -253 1.67108 0.261
NP_443040.1_1 Forward -254 -240 13.5661 0.276
NP_441329.1_1 Reverse -302 -321 6.73176 0.251
NP_441895.1_10 Forward -218 -199 -19.2734 0.282
NP_442669.1_1 Forward -152 -133 2.85105 0.175
NP_440945.1_1 Reverse -290 -309 6.19431 0.292
NP_440219.1_1 Reverse -205 -224 14.9422 0.186
NP_441769.1_3 Forward -333 -314 -2.95123 0.245
NP_441541.1_1 Reverse -110 -128 2.58027 0.195
NP_441541.1_1 Forward -138 -120 -3.05376 0.264
NP_440833.1_6 Forward -383 -369 10.1271 0.255
NP_441848.1_4 Forward -122 -106 12.2298 0.208
NP_442844.1_2 Forward -220 -205 12.5664 0.29
NP_442532.1_1 Forward -123 -109 14.2922 0.215
NP_441186.1_4 Forward -216 -206 17.0891 0.223
NP_441460.1_5 Reverse -240 -254 13.2736 0.291
NP_441401.1_1 Reverse -288 -307 15.0441 0.135
NP_441401.1_4 Forward -251 -238 16.5389 0.131
NP_440358.1_8 Forward -75 -56 -0.983855 0.274
NP_442090.1_2 Reverse -207 -226 8.25963 0.281
NP_440560.1_5 Reverse -146 -165 17.6202 0.0646
NP_440216.1_9 Reverse -367 -376 14.651 0.172
NP_440216.1_9 Forward -257 -248 5.80125 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATATGCATTTATTCTGGTAAACTTTCCCATGGACTCAAGTCTATGTTTGAAGCAATATCATTAATAAATGACATGAATATATTGAATTTTGAAAATCTCGTGATTCAAGCCACCAATCTTATAAAAGAAGAAAATAGTGGGCCAAGAAAAATTGATGAAATGACCATCCAATATTTAGTAAATTCACAAAAATGGTTTCGTATAAATGATGAAAATGAGCGACTAGATGCGCTTCAAAAATGCTTGTTAGAATCTGATTAAAATTATGACTTATTATAATAAGTAAAATACTCAATTATTCATTTTGTAGAGTAACTTTCACAGTCCTTGACTGTTTGAATGACATCCGTAGATTCCATTACTCAACACACTAATGTTCAATCCGGCTTTTGAGAATT

CDS

ATGACCCAAGCCCAAGCCAAGCGTTTTCAGTTTGATCGCCAACTGTGGCACCGCTTTGTTGAAACTGCCCAGCCCTATTTTTATCCGGTGGGGCAAAAGCAAACTCGGGTTTTTCTCGGTCTCATCCTGGCCCTCATGGTGGTGGTGGTGGCCTTGACCCTATTTTTATCCATGGGGTTGACCCTCTGGGCCACAGCAATTTTCCCTGACTTTTTTGCTAAATCTGGTGAGGGTTTGGTAGATGGGGTACAAGGTCTGATCAATTCCCCGGCTCCTTGGATCGGTTTAGTGGCCTTGGCCATGGCCGGGGCTGTTTTCATCAGCCAGCGCCAAAAATTACAACAACGGTGGCTCCAGTGGTTGCTGTTGGGCGTATTATTATCTCTACTATTTGTTGTCAACGGCTTAAACGTTATTTTAAGCTTTGTTTTTCGCTTCATTGATACAGCTTTAAACGGCAAAGATGCAGAAGTATTTTGGCAATTTCTCTGGATTTATGGCATTGTCATTGTGGTGGCTATTCCCATCATTGTGGCCTACCGCTATTTACGACAAAAGTTAGGGGTGCTCTGGCGGCAATGGCTGACGGAACACTTTCTTGGCCGCTACTTTAAAGGGCGTTCCTACTATCATCTCGACTCCAATTCTGCCTATACCTTAATTGATAATCCCGACCAAAGGATAACCCAGGATATCCAATCCTTTACCGGGGTTACTCTGGATTTTTTATTGGATATCCTTGACTCCATCCTCACCTTAATTTCCTTTACCGCCATCCTCTACACCATTTCCCAAACCCTTATGTGGGGGTTGATTGGTTATGCGGTCTTCGGGACAGTGGTGGCGATCGCCATTGGCACTAGGCTAATCCGCATTAACTATGAACAACTGCGGTTGGAAGCTAATTTCCGTTACGGCTTGGTGCGGGTAAGAGATAACGCCGAATCCATCGCTTTTTACCGGGGAGAAGGGCTAGAGCGGAAACAGGTTACGGATCGTTTGCTAGGGGCGATTAGAAACTTTAATTTACTAATTATTTGGCAAGCTTTAATCAGCCTATTTCAGCTAGGCTATAACTATTTCACCAGGCTAATTCCCTATATTATTATCGCCCCCCTTTACCTCGCAGGAGACCTGGACTTCGGGGCGATCGCCCAAGCTAGTTTGGCCTTTGGCATGGTCCTTTCTGCCCTATCTCTAGTAACCAACCAGATTCAAAATATTACTGAATTTGCCGCCAGCATTAACCGTTTAGGAGAATTTTACGAATCTTTAAATGGCCCCAGCAATGAATTGGAACGGCCGGAAAGTACTGGTTTTGACCACAACGTTATCACAACCCGTATTGGTGCCACCGTTGCCCTGGAAAATGTCACCCTTTCTCCCCCCAATTCCTCACGGATTTTGGTACGGGATTTATCCCTGGCCGTGGCTCCCGGTAACCATCTGTTGATCATGGGCCCAAGCGGGAGTGGCAAAAGCTCTCTCCTCCGGGCGATCGCCGGTTTATGGGACAGCGGTCAAGGCACCATTGAACGACCTGAACTGGCGGACTTATTATTTTTACCCCAACGGCCCTACATGATTTTGGGCACCCTGCGTGAACAGTTGATTTACCCCAGTGCCCAATCCATAGCGGACGACGATTTTCTCTTGGAAACTTTAAACAAGGTTAATCTACCGGACTTAGCCGAGCGTTTTGGTGGTTTGGATAGCCTGGAAAATTGGTCCAGCGTCCTTTCCCTGGGGGAACAACAACGTATTGCCCTAGCCCGAGTTTTCATCAACCAACCCCGCTATGCCATCCTCGACGAAGCCACCAGCGCTCTGGATGTGAATAACGAGGCGGAACTCTACCATGCTCTGACGGATTTGGGTACAACCTTCATCAGCGTGGGACATCGACCTACCCTGCGAAATTTTCACCGGCAATGTTTGGAAGTTCAGGCAGAGGGACGGTGGCAAATAAGCCCCATTAACAATTAA

Protein

MTQAQAKRFQFDRQLWHRFVETAQPYFYPVGQKQTRVFLGLILALMVVVVALTLFLSMGLTLWATAIFPDFFAKSGEGLVDGVQGLINSPAPWIGLVALAMAGAVFISQRQKLQQRWLQWLLLGVLLSLLFVVNGLNVILSFVFRFIDTALNGKDAEVFWQFLWIYGIVIVVAIPIIVAYRYLRQKLGVLWRQWLTEHFLGRYFKGRSYYHLDSNSAYTLIDNPDQRITQDIQSFTGVTLDFLLDILDSILTLISFTAILYTISQTLMWGLIGYAVFGTVVAIAIGTRLIRINYEQLRLEANFRYGLVRVRDNAESIAFYRGEGLERKQVTDRLLGAIRNFNLLIIWQALISLFQLGYNYFTRLIPYIIIAPLYLAGDLDFGAIAQASLAFGMVLSALSLVTNQIQNITEFAASINRLGEFYESLNGPSNELERPESTGFDHNVITTRIGATVALENVTLSPPNSSRILVRDLSLAVAPGNHLLIMGPSGSGKSSLLRAIAGLWDSGQGTIERPELADLLFLPQRPYMILGTLREQLIYPSAQSIADDDFLLETLNKVNLPDLAERFGGLDSLENWSSVLSLGEQQRIALARVFINQPRYAILDEATSALDVNNEAELYHALTDLGTTFISVGHRPTLRNFHRQCLEVQAEGRWQISPINN