Your browser is old and dusty. Try Google Chrome!

Details for sll0168

ORF sll0168
Accession NP_441991.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -320 -334 11.701 0.0507
NP_441061.1_2 Reverse -326 -340 6.29277 0.121
NP_441061.1_2 Reverse -314 -328 -1.67204 0.269
NP_440795.1_7 Reverse -156 -163 6.92228 0.26
NP_441418.1_6 Forward -113 -94 -20.5517 0.117
NP_441418.1_6 Reverse -319 -338 -21.0434 0.136
NP_441418.1_6 Forward -374 -355 -28.5165 0.205
NP_441418.1_6 Forward -116 -97 -28.9099 0.213
NP_441418.1_6 Reverse -325 -344 -29.4998 0.228
NP_441418.1_6 Forward -164 -145 -29.9915 0.249
NP_440897.1_6 Reverse -325 -344 8.84842 0.0706
NP_441453.1_8 Forward -263 -246 9.77361 0.239
NP_441960.1_3 Reverse -125 -144 14.7512 0.237
NP_441818.1_1 Reverse -320 -331 12.8412 0.102
NP_441818.1_9 Forward -334 -315 -7.67036 0.273
NP_442287.1_5 Forward -218 -208 14.533 0.223
NP_443027.1_4 Forward -330 -320 10.3048 0.134
NP_443027.1_4 Reverse -203 -213 9.61647 0.159
NP_441812.1_3 Forward -396 -382 6.6861 0.298
NP_441225.1_4 Reverse -315 -334 -12.1936 0.284
NP_441250.1_3 Reverse -186 -205 2.16274 0.28
NP_441250.1_3 Reverse -254 -273 1.96607 0.281
NP_440061.1_9 Forward -167 -153 8.16044 0.18
NP_440110.1_8 Forward -166 -147 -2.36049 0.266
NP_439979.1_2 Reverse -325 -344 11.9958 0.18
NP_440878.1_9 Forward -37 -18 3.34271 0.174
NP_442062.1_3 Reverse -186 -205 -2.55715 0.272
NP_440304.1_4 Forward -330 -320 6.96153 0.137
NP_440304.1_4 Forward -363 -353 4.60159 0.258
NP_442762.1_10 Reverse -141 -160 -2.36049 0.211
NP_442762.1_10 Reverse -146 -165 -11.2103 0.275
NP_442207.1_5 Reverse -302 -321 13.8641 0.212
NP_442602.1_3 Reverse -216 -235 -0.39387 0.22
NP_441208.1_1 Forward -187 -168 -6.49039 0.287
NP_441083.1_3 Reverse -154 -164 11.8776 0.297
NP_442827.1_8 Forward -393 -374 -1.8696 0.26
NP_440109.1_7 Reverse -77 -96 14.6508 0.255
NP_440209.1_1 Reverse -325 -333 2.08437 0.286
NP_440808.1_1 Reverse -196 -215 16.8141 0.22
NP_441792.1_5 Reverse -314 -330 9.98996 0.234
NP_442949.1_6 Reverse -194 -213 15.4374 0.291
NP_440747.1_10 Reverse -322 -334 -12.2524 0.254
NP_440747.1_10 Reverse -316 -328 -12.2524 0.254
NP_440944.1_2 Forward -268 -249 6.98095 0.175
NP_442634.1_4 Forward -216 -202 4.12949 0.0841
NP_442634.1_4 Forward -330 -316 -4.91696 0.223
NP_442848.1_1 Forward -334 -320 4.32615 0.106
NP_443018.1_3 Forward -394 -387 10.2655 0.107
NP_443018.1_3 Reverse -266 -273 8.49558 0.141
NP_443018.1_3 Forward -333 -326 4.26735 0.267
NP_443018.1_3 Reverse -326 -333 4.07068 0.299
NP_441634.1_8 Forward -166 -152 2.75286 0.163
NP_441634.1_8 Forward -397 -383 -1.5737 0.294
NP_441991.1_3 Forward -302 -283 19.0748 0.205
NP_441991.1_10 Forward -182 -163 23.0089 0.0506
NP_440376.1_1 Forward -361 -352 1.67135 0.243
NP_442485.1_3 Forward -166 -147 -3.3438 0.273
NP_442946.1_7 Forward -277 -262 12.0331 0.284
NP_440642.1_10 Forward -314 -300 6.98048 0.224
NP_440642.1_10 Forward -41 -27 4.71887 0.25
NP_440360.1_5 Reverse -89 -108 -5.80207 0.297
NP_440360.1_10 Reverse -100 -114 2.65453 0.261
NP_442658.1_1 Forward -336 -326 11.6809 0.0768
NP_442658.1_1 Reverse -198 -208 4.99446 0.288
NP_440353.1_2 Reverse -73 -92 10.7167 0.202
NP_440141.1_8 Forward -343 -324 8.84924 0.23
NP_441414.1_9 Reverse -28 -47 -5.9004 0.182
NP_441478.1_3 Forward -240 -221 12.0942 0.244
NP_441317.1_4 Forward -98 -84 9.55945 0.29
NP_440203.1_5 Reverse -322 -332 16.7941 0.0611
NP_439905.1_1 Reverse -206 -219 8.47575 0.234
NP_439990.1_5 Reverse -387 -400 6.90245 0.22
NP_439990.1_7 Forward -84 -65 13.7658 0.18
NP_442911.1_2 Reverse -309 -328 -2.95047 0.105
NP_442064.1_4 Forward -344 -325 14.9449 0.142
NP_442064.1_4 Reverse -249 -268 8.16011 0.235
NP_442536.1_7 Forward -334 -315 7.47261 0.273
NP_443055.1_6 Reverse -200 -218 -2.53818 0.296
NP_440827.1_3 Forward -372 -353 10.6192 0.298
NP_442210.1_2 Forward -109 -90 18.289 0.0299
NP_441913.1_3 Reverse -192 -205 15.3405 0.218
NP_441099.1_5 Reverse -315 -334 -8.65367 0.201
NP_442438.1_10 Reverse -150 -164 -0.000409212 0.244
NP_442431.1_10 Forward -220 -202 6.11567 0.195
NP_442771.1_1 Forward -174 -156 -9.81395 0.232
NP_440147.1_4 Forward -258 -245 0.0192843 0.268
NP_441041.1_4 Forward -334 -315 8.45592 0.0331
NP_441725.1_4 Reverse -314 -328 2.94893 0.279
NP_441725.1_5 Reverse -353 -363 -0.806614 0.271
NP_441725.1_5 Reverse -320 -330 -1.00328 0.279
NP_441725.1_5 Reverse -326 -336 -1.10161 0.288
NP_439966.1_7 Forward -161 -151 4.40448 0.273
NP_442941.1_3 Reverse -320 -330 0.668351 0.19
NP_442281.1_1 Forward -400 -386 6.19383 0.133
NP_442281.1_1 Forward -333 -319 2.75226 0.257
NP_441644.1_6 Reverse -314 -324 7.25606 0.132
NP_441644.1_6 Forward -395 -385 5.97777 0.172
NP_441644.1_6 Forward -328 -318 5.28945 0.199
NP_441644.1_6 Reverse -386 -396 4.99446 0.216
NP_441644.1_6 Forward -334 -324 3.12618 0.297
NP_442215.1_2 Reverse -263 -279 -6.13632 0.264
NP_440430.1_4 Forward -338 -319 15.5349 0.214
NP_442554.1_8 Reverse -320 -330 12.1731 0.0287
NP_442554.1_8 Forward -394 -384 5.68323 0.141
NP_442554.1_8 Reverse -387 -397 3.91327 0.203
NP_442554.1_8 Reverse -326 -336 3.22496 0.235
NP_442554.1_8 Forward -400 -390 3.02829 0.245
NP_442554.1_8 Forward -327 -317 3.02829 0.245
NP_440133.1_10 Reverse -180 -199 7.96426 0.181
NP_442142.1_4 Reverse -322 -335 10.7368 0.0679
NP_442142.1_4 Forward -398 -385 9.26181 0.0998
NP_442142.1_4 Reverse -143 -156 7.59019 0.135
NP_442142.1_4 Forward -125 -112 7.59019 0.135
NP_442142.1_4 Reverse -95 -108 5.23026 0.197
NP_442142.1_4 Forward -337 -324 3.65697 0.248
NP_442292.1_1 Reverse -320 -329 13.4711 0.0183
NP_442381.1_7 Reverse -156 -169 17.0305 0.26
NP_443009.1_5 Forward -165 -154 6.64635 0.154
NP_442301.1_2 Reverse -94 -113 8.25844 0.23
NP_442408.2_1 Reverse -353 -372 -7.27704 0.297
NP_441613.1_3 Forward -117 -98 26.7547 0.000125
NP_440379.1_5 Forward -164 -145 -6.68705 0.238
NP_440379.1_5 Forward -343 -324 -8.55534 0.253
NP_441468.1_1 Forward -333 -326 4.07068 0.263
NP_441468.1_1 Forward -327 -320 3.97235 0.277
NP_441015.1_10 Forward -187 -168 -11.6036 0.298
NP_441172.1_8 Forward -114 -100 18.1908 0.151
NP_441826.1_2 Reverse -386 -400 2.45787 0.127
NP_441826.1_2 Forward -334 -320 0.982901 0.167
NP_441826.1_5 Forward -116 -97 3.04771 0.272
NP_442868.1_6 Forward -166 -156 6.56821 0.107
NP_441612.1_2 Forward -128 -118 7.38753 0.255
NP_442559.1_7 Reverse -11 -30 18.584 0.238
NP_442227.1_2 Reverse -103 -122 2.3594 0.233
NP_442820.1_9 Reverse -265 -283 5.52568 0.262
NP_442718.1_2 Forward -217 -198 -2.65548 0.277
NP_442542.1_2 Forward -336 -323 5.42749 0.266
NP_440342.1_2 Forward -164 -145 16.5191 0.108
NP_441114.1_3 Reverse -267 -276 7.66954 0.231
NP_440558.1_2 Forward -137 -118 8.06259 0.113
NP_442576.1_9 Forward -273 -259 17.7731 0.174
NP_441878.1_6 Forward -396 -386 0.668351 0.139
NP_441878.1_6 Reverse -385 -395 0.668351 0.139
NP_441878.1_6 Forward -275 -265 -7.49312 0.231
NP_441878.1_6 Forward -362 -352 -7.78811 0.266
NP_441878.1_6 Forward -215 -205 -7.98478 0.285
NP_441036.1_6 Forward -185 -167 7.98396 0.292
NP_440101.1_10 Forward -110 -91 5.01433 0.208
NP_442397.1_9 Forward -172 -153 9.73422 0.246
NP_441574.1_1 Forward -116 -97 1.47442 0.173
NP_441574.1_1 Forward -104 -85 -3.04881 0.234
NP_441574.1_1 Reverse -253 -272 -6.39206 0.277
NP_442170.1_5 Forward -289 -270 4.22769 0.167
NP_442645.1_2 Reverse -317 -336 -17.4051 0.254
NP_442594.1_8 Forward -119 -100 3.14605 0.288
NP_442764.1_8 Forward -285 -266 7.96426 0.179
NP_440299.1_1 Reverse -175 -188 4.24695 0.213
NP_441799.1_4 Forward -133 -114 3.44104 0.133
NP_441007.1_10 Forward -112 -99 9.65572 0.0892
NP_440256.1_1 Reverse -322 -341 3.44104 0.0523
NP_440256.1_1 Reverse -316 -335 -9.63698 0.284
NP_441559.1_8 Reverse -161 -175 -5.50694 0.264
NP_441559.1_8 Reverse -151 -165 -7.57189 0.295
NP_440915.1_6 Reverse -146 -160 -1.77037 0.246
NP_440749.1_4 Forward -52 -34 9.6548 0.277
NP_440748.1_5 Reverse -310 -329 1.86774 0.224
NP_441464.1_8 Forward -164 -150 8.65272 0.194
NP_441199.1_6 Forward -171 -152 -1.27885 0.289
NP_442993.1_1 Forward -395 -379 -13.1178 0.286
NP_442386.1_9 Reverse -324 -333 4.52254 0.297
NP_441750.1_1 Forward -116 -97 -5.9004 0.221
NP_441340.1_5 Reverse -326 -333 3.97235 0.274
NP_440327.1_6 Reverse -254 -273 5.11266 0.265
NP_440327.1_6 Forward -377 -358 3.44104 0.285
NP_442714.1_7 Forward -208 -189 -0.983855 0.279
NP_440211.1_4 Forward -269 -259 16.303 0.215
NP_440586.1_8 Reverse -326 -333 9.57686 0.146
NP_440586.1_8 Forward -394 -387 9.08521 0.178
NP_443038.1_4 Forward -104 -85 13.0775 0.208
NP_439996.1_2 Reverse -144 -163 3.73603 0.244
NP_439943.1_3 Reverse -255 -274 11.6025 0.265
NP_441138.1_5 Reverse -251 -264 3.97694 0.297
NP_441181.1_6 Reverse -326 -344 3.46073 0.281
NP_440316.1_10 Forward -335 -325 10.5998 0.226
NP_439977.1_5 Reverse -313 -332 8.16093 0.107
NP_440364.1_6 Forward -335 -322 18.1116 0.136
NP_442262.1_10 Forward -394 -387 9.18389 0.211
NP_442262.1_10 Reverse -266 -273 8.59391 0.22
NP_442262.1_10 Reverse -320 -327 8.10225 0.257
NP_441689.1_5 Forward -264 -254 4.99446 0.285
NP_440163.1_10 Forward -398 -388 13.5497 0.122
NP_440344.1_10 Forward -341 -324 -12.0559 0.239
NP_440297.1_9 Reverse -353 -363 0.0783647 0.282
NP_440297.1_9 Forward -360 -350 -0.118297 0.282
NP_440297.1_9 Reverse -320 -330 -0.118297 0.282
NP_440297.1_9 Reverse -326 -336 -0.216628 0.282
NP_440297.1_9 Reverse -387 -397 -0.511621 0.289
NP_442280.1_10 Forward -49 -31 8.47384 0.258
NP_440990.1_10 Forward -122 -103 15.4374 0.261
NP_440999.1_2 Forward -267 -248 9.53756 0.275
NP_440999.1_9 Reverse -315 -329 -1.08205 0.226
NP_440999.1_9 Reverse -103 -117 -3.24533 0.289
NP_440888.1_2 Reverse -353 -367 9.43874 0.127
NP_440888.1_2 Reverse -247 -261 6.19383 0.243
NP_440888.1_2 Reverse -325 -339 5.30886 0.284
NP_439969.1_3 Reverse -360 -379 1.96607 0.249
NP_441543.1_2 Reverse -326 -335 6.78456 0.138
NP_441543.1_2 Reverse -320 -329 4.91628 0.213
NP_442845.1_2 Forward -334 -320 5.60446 0.228
NP_442845.1_2 Reverse -319 -333 3.93283 0.272
NP_441469.1_8 Reverse -351 -360 10.5211 0.212
NP_441469.1_8 Forward -335 -326 5.21127 0.283
NP_442315.1_1 Forward -115 -97 6.70565 0.256
NP_440220.1_4 Reverse -252 -271 -0.689632 0.262
NP_441560.1_8 Reverse -254 -273 13.1683 0.229
NP_440516.1_6 Forward -46 -32 7.57046 0.27
NP_440516.1_8 Forward -334 -325 -0.196935 0.185
NP_442428.1_5 Forward -333 -326 4.46401 0.267
NP_442428.1_5 Forward -327 -320 4.46401 0.267
NP_442120.1_10 Forward -334 -315 -15.9302 0.296
NP_440673.1_3 Reverse -249 -256 9.08556 0.202
NP_440673.1_7 Reverse -148 -167 -0.0988766 0.283
NP_441052.1_2 Reverse -386 -396 3.91327 0.17
NP_441052.1_2 Reverse -365 -375 2.04498 0.22
NP_441052.1_2 Forward -395 -385 0.865012 0.256
NP_440436.1_4 Reverse -326 -335 11.9957 0.0435
NP_440436.1_4 Reverse -320 -329 4.52254 0.256
NP_440314.1_9 Reverse -129 -148 -10.227 0.291
NP_442907.1_9 Reverse -297 -316 -2.55715 0.257
NP_441004.1_1 Forward -377 -358 -5.01543 0.175
NP_441004.1_1 Forward -116 -97 -10.4236 0.219
NP_442873.1_9 Reverse -343 -362 8.65176 0.236
NP_442206.1_10 Forward -328 -313 7.64971 0.178
NP_442854.1_6 Forward -328 -309 0.687771 0.29
NP_441851.1_10 Forward -362 -352 5.19158 0.221
NP_441851.1_10 Forward -329 -319 4.69992 0.254
NP_441157.1_1 Forward -201 -187 5.70218 0.235
NP_442856.1_7 Reverse -356 -375 -2.55715 0.236
NP_441668.1_4 Reverse -256 -275 1.47442 0.214
NP_442515.1_1 Forward -362 -348 1.17956 0.168
NP_440593.1_3 Reverse -174 -193 -6.09707 0.27
NP_441982.1_6 Reverse -65 -74 13.8222 0.274
NP_442843.1_1 Reverse -266 -285 -11.5053 0.291
NP_439960.1_4 Reverse -324 -343 14.7483 0.172
NP_440726.1_2 Reverse -358 -377 -0.787193 0.295
NP_441477.1_8 Forward -161 -142 18.289 0.0914
NP_441031.1_8 Reverse -102 -121 10.6192 0.137
NP_442006.1_2 Forward -113 -96 -13.5308 0.197
NP_442006.1_2 Reverse -325 -342 -17.0707 0.269
NP_440483.1_1 Reverse -145 -164 -3.73712 0.218
NP_441570.1_1 Forward -334 -316 -8.43732 0.112
NP_441078.1_4 Forward -395 -386 -1.6719 0.266
NP_441078.1_4 Reverse -386 -395 -1.77023 0.266
NP_441078.1_4 Forward -328 -319 -1.96689 0.282
NP_441078.1_4 Forward -334 -325 -2.06522 0.295
NP_442729.1_8 Forward -170 -157 5.32916 0.251
NP_440707.1_9 Forward -115 -96 6.39097 0.235
NP_441432.1_8 Forward -329 -320 4.42462 0.213
NP_442320.1_8 Forward -340 -326 -6.29359 0.277
NP_441732.1_2 Reverse -315 -331 -7.31629 0.0807
NP_441732.1_2 Reverse -85 -101 -17.2477 0.247
NP_440629.1_4 Reverse -297 -316 12.2908 0.217
NP_442797.1_6 Reverse -97 -116 10.1642 0.24
NP_442797.1_7 Forward -368 -350 0.412472 0.274
NP_440199.1_10 Forward -398 -388 15.6147 0.0861
NP_441057.1_4 Forward -117 -99 -3.6191 0.295
NP_442400.1_10 Reverse -71 -84 7.79662 0.282
NP_442400.1_10 Forward -265 -252 7.70113 0.282
NP_440713.1_4 Reverse -145 -164 6.68596 0.187
NP_440713.1_4 Reverse -146 -165 4.916 0.219
NP_442489.1_7 Reverse -386 -395 5.21127 0.077
NP_442489.1_7 Forward -334 -325 -1.37691 0.195
NP_442489.1_7 Forward -395 -386 -1.6719 0.235
NP_442489.1_7 Forward -328 -319 -1.6719 0.235
NP_440565.1_3 Forward -30 -11 16.4506 0.218
NP_442913.1_10 Reverse -271 -290 -2.36049 0.184
NP_442913.1_10 Reverse -377 -396 -5.11376 0.257
NP_439956.1_8 Forward -334 -315 11.4058 0.289
NP_442346.1_5 Reverse -324 -334 10.3048 0.101
NP_442346.1_5 Forward -396 -386 5.5849 0.238
NP_442346.1_5 Forward -329 -319 4.99491 0.267
NP_442346.1_5 Reverse -385 -395 4.50326 0.286
NP_440545.1_3 Forward -332 -315 1.8088 0.112
NP_441126.1_8 Forward -110 -97 6.1158 0.291
NP_440010.1_4 Reverse -321 -340 1.86696 0.227
NP_441585.1_5 Reverse -145 -164 5.30853 0.225
NP_441888.1_7 Reverse -314 -328 1.86788 0.235
NP_441948.1_4 Reverse -148 -166 -3.02911 0.181
NP_440671.1_6 Reverse -137 -156 16.4199 0.135
NP_442199.1_5 Reverse -306 -325 -1.27885 0.18
NP_442140.1_3 Forward -106 -96 6.07655 0.184
NP_442723.1_1 Forward -172 -153 4.81688 0.276
NP_440875.1_9 Forward -393 -383 7.88535 0.255
NP_440875.1_9 Reverse -202 -212 7.30133 0.269
NP_440821.1_4 Forward -336 -326 -0.41329 0.257
NP_441239.1_9 Reverse -317 -329 9.47875 0.105
NP_441239.1_9 Reverse -153 -165 6.33216 0.193
NP_441239.1_9 Reverse -384 -396 3.77555 0.276
NP_441892.1_1 Forward -283 -266 -1.23946 0.201
NP_440665.1_1 Forward -164 -145 -14.6519 0.262
NP_440665.1_1 Reverse -107 -126 -14.7502 0.264
NP_440665.1_1 Forward -377 -358 -15.3402 0.267
NP_442193.1_8 Forward -331 -312 11.7 0.257
NP_441698.1_2 Forward -74 -55 16.0013 0.238
NP_440900.1_3 Forward -377 -358 18.9773 0.173
NP_441509.1_9 Forward -137 -118 19.0757 0.0919
NP_441868.1_4 Reverse -149 -163 14.0609 0.282
NP_441868.1_4 Forward -224 -210 12.3893 0.284
NP_442402.1_4 Reverse -284 -303 -6.58946 0.259
NP_442039.1_7 Forward -272 -262 13.943 0.211
NP_441701.1_3 Forward -332 -315 15.4768 0.183
NP_441701.1_3 Reverse -115 -132 8.88863 0.247
NP_440914.1_1 Forward -334 -324 13.5923 0.0274
NP_440914.1_1 Forward -328 -318 10.4693 0.136
NP_440914.1_1 Reverse -200 -210 7.5416 0.232
NP_440068.1_1 Forward -191 -172 -1.7705 0.249
NP_442533.1_1 Forward -116 -97 -1.86883 0.14
NP_442533.1_6 Reverse -386 -395 6.8829 0.101
NP_442533.1_6 Forward -395 -386 6.78456 0.103
NP_442533.1_6 Reverse -352 -361 4.32629 0.184
NP_441482.1_7 Reverse -313 -327 -5.40861 0.182
NP_441235.1_5 Reverse -31 -50 13.7658 0.229
NP_441028.1_6 Forward -231 -221 5.58445 0.246
NP_442664.1_3 Reverse -148 -162 14.3559 0.246
NP_440007.1_9 Forward -332 -318 4.12949 0.267
NP_440007.1_9 Reverse -115 -129 4.03116 0.267
NP_440007.1_9 Forward -293 -279 1.96621 0.281
NP_441680.1_4 Forward -132 -113 -3.24547 0.288
NP_441170.1_4 Reverse -147 -165 1.69077 0.299
NP_441106.1_1 Forward -335 -326 11.7011 0.0311
NP_440429.1_9 Reverse -137 -156 5.60432 0.211
NP_439903.1_6 Reverse -316 -335 0.686995 0.258
NP_442306.1_10 Reverse -381 -400 -19.8634 0.201
NP_440670.1_8 Forward -328 -319 3.53964 0.257
NP_440886.1_7 Reverse -103 -113 6.0761 0.147
NP_440886.1_7 Reverse -324 -334 3.71617 0.267
NP_441021.1_1 Reverse -320 -339 -9.63698 0.218
NP_440841.1_4 Forward -276 -257 -7.96535 0.25
NP_441463.1_1 Forward -217 -199 11.7205 0.273
NP_441463.1_3 Reverse -315 -334 3.53937 0.101
NP_441463.1_3 Reverse -195 -214 -3.3438 0.174
NP_441463.1_3 Reverse -255 -274 -4.6221 0.209
NP_442211.1_3 Forward -334 -315 7.08295 0.29
NP_442794.1_1 Forward -338 -326 3.48056 0.286
NP_441962.1_4 Reverse -320 -339 -12.0953 0.252
NP_441431.1_2 Forward -185 -171 5.89884 0.284
NP_441425.1_6 Forward -75 -65 16.008 0.252
NP_441817.1_7 Forward -104 -85 14.7491 0.265
NP_441206.1_4 Reverse -195 -214 -4.32711 0.263
NP_440287.1_6 Forward -244 -225 4.22769 0.206
NP_440293.1_3 Reverse -144 -163 -5.60541 0.28
NP_441237.1_9 Reverse -266 -276 11.9764 0.146
NP_441133.1_3 Forward -116 -97 13.2741 0.272
NP_440502.1_7 Forward -276 -257 13.6675 0.268
NP_440457.1_1 Forward -365 -353 6.62715 0.116
NP_440457.1_1 Reverse -151 -163 -0.452677 0.263
NP_441984.1_3 Reverse -382 -400 5.91901 0.276
NP_441332.1_6 Reverse -351 -361 11.8404 0.244
NP_440554.1_4 Reverse -326 -336 1.84832 0.287
NP_440478.1_10 Reverse -153 -167 8.45605 0.257
NP_442341.1_9 Reverse -317 -331 7.47213 0.198
NP_442275.1_1 Forward -164 -145 -0.295539 0.295
NP_440679.1_5 Reverse -322 -341 6.78429 0.292
NP_442686.1_9 Reverse -96 -115 11.0117 0.231
NP_441122.1_1 Reverse -261 -276 12.8613 0.155
NP_440804.1_7 Reverse -72 -89 10.5595 0.222
NP_442373.1_1 Forward -174 -155 -2.16383 0.185
NP_442373.1_2 Forward -119 -100 -11.3086 0.293
NP_440216.1_9 Forward -272 -263 7.17789 0.286
NP_440172.1_1 Forward -328 -318 6.37155 0.105
NP_440172.1_1 Forward -334 -324 3.71661 0.219
NP_440249.1_2 Reverse -67 -77 15.7125 0.268
NP_441226.1_7 Reverse -353 -360 8.59356 0.197
NP_442417.1_5 Reverse -325 -339 11.2093 0.105
NP_440416.1_9 Reverse -198 -217 -11.9969 0.155
NP_443052.1_9 Reverse -97 -116 10.1275 0.106
NP_442154.1_1 Forward -115 -97 -4.01242 0.125
NP_442046.1_8 Reverse -353 -372 15.1424 0.272
NP_440261.1_5 Reverse -206 -219 -5.09393 0.185
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAATGGCCATGGACTGTAATCAGCTTTCCATCACGGAGGGGGACGGCACTATTAATTTCCACTACGACGATGGCGATGTCATGGGTTTTTCTTTCGTGCTGGAATACAATGACGACCCCATACTGGTCAATGGCAAAATCAATAGCAATCAGTACAATGTCATTGGTACTTTTCTCTGGACTGCGGAAGATGGCATTGTTGACGAAACTTTAACGGAGGCCACAGGGAACTGTCGGGCCACCCCAGCCCAGGTGGTTTGTCAGGCTACCATTGACAACACCATGAAGGTGGAAGCGGTGGTGGATTTCTAGTTTGTTTAGGTTAATTTTTGAGCACCATTGAGCTTATTCCCTCTACTTTTCCCTGATCTTCCGTAGTTGCACTGTTTCCTTAGTTGAG

CDS

GTGTTGATGAAATGTTGGTTAGCGGCGGCGGATTTGCTGGTGATTGCCGCTGAAGATTTGCCAGCTTACAAAAAAGGTGGTTCCATTGTTCGGAATAATTATTTTTGGGCCCTCCAGGCGATCGCCTGTCACAGCGGGCGGGGTCGAGATTGGGAGTTCGACGAAGTGGTGTGGGTAGCCCTGGGGAGACTATTGCTGTTTTTTCTTAATTCTGGTTATCTGATGACATCCGAAACCCTGCTGGAATTTCCCTGTGATGAAGTTATTCCCCTTAGCCTGCGGTCGGTGGCCACCTGGCAAGCTCCCGGGGACGATGGAGGACTAGAATCGTTTTGA

Protein

MLMKCWLAAADLLVIAAEDLPAYKKGGSIVRNNYFWALQAIACHSGRGRDWEFDEVVWVALGRLLLFFLNSGYLMTSETLLEFPCDEVIPLSLRSVATWQAPGDDGGLESF