Your browser is old and dusty. Try Google Chrome!

Details for sll0167

ORF sll0167
Accession NP_441992.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -223 -204 4.22769 0.186
NP_440815.1_5 Reverse -129 -148 8.75091 0.232
NP_442291.1_5 Reverse -78 -94 -3.57971 0.245
NP_440897.1_6 Reverse -271 -290 -4.62285 0.285
NP_442151.1_6 Forward -224 -210 13.6676 0.0474
NP_442151.1_6 Reverse -215 -229 6.58777 0.228
NP_441818.1_6 Reverse -100 -114 9.5377 0.274
NP_441818.1_9 Reverse -191 -210 -4.52377 0.238
NP_443002.1_5 Forward -211 -193 11.0314 0.255
NP_442173.1_5 Reverse -173 -183 15.9202 0.287
NP_001035873.1_6 Reverse -309 -328 19.0757 0.281
NP_443027.1_4 Forward -226 -216 5.87989 0.294
NP_443027.1_4 Reverse -213 -223 5.78156 0.298
NP_442975.1_10 Reverse -211 -225 6.19383 0.188
NP_440784.1_7 Reverse -216 -223 9.38056 0.119
NP_440784.1_7 Forward -223 -216 9.38056 0.119
NP_441250.1_3 Forward -252 -233 4.03102 0.252
NP_440061.1_9 Reverse -344 -358 11.012 0.117
NP_440061.1_9 Forward -108 -94 5.70218 0.275
NP_440061.1_9 Forward -175 -161 5.01387 0.298
NP_442405.1_3 Forward -335 -323 16.853 0.288
NP_442062.1_8 Forward -138 -128 3.91327 0.243
NP_441802.1_1 Reverse -167 -186 6.29264 0.269
NP_440304.1_4 Reverse -294 -304 2.14332 0.299
NP_442242.1_4 Forward -223 -216 9.18389 0.271
NP_442242.1_4 Reverse -216 -223 9.18389 0.271
NP_440908.1_5 Reverse -303 -320 8.98696 0.271
NP_442762.1_10 Reverse -266 -285 0.884433 0.0698
NP_439918.1_2 Reverse -197 -216 3.73603 0.181
NP_441200.1_4 Reverse -165 -184 11.7008 0.172
NP_441935.1_1 Forward -364 -345 5.30933 0.293
NP_441208.1_9 Reverse -262 -276 6.19444 0.253
NP_441594.1_6 Reverse -206 -225 13.1758 0.109
NP_442110.1_7 Forward -112 -98 2.5562 0.222
NP_441925.1_4 Forward -105 -86 -11.7026 0.253
NP_441925.1_4 Reverse -349 -368 -14.8492 0.263
NP_441925.1_4 Reverse -348 -367 -15.2425 0.263
NP_441083.1_3 Forward -281 -271 15.0242 0.138
NP_442827.1_8 Forward -232 -213 11.7983 0.05
NP_441738.1_2 Forward -114 -107 8.1019 0.204
NP_441558.1_5 Reverse -269 -288 5.89931 0.236
NP_440178.1_7 Reverse -31 -50 -22.125 0.255
NP_442570.1_3 Reverse -14 -33 -9.44032 0.299
NP_440343.1_8 Forward -226 -207 19.9606 0.101
NP_440747.1_10 Forward -277 -265 -12.5474 0.297
NP_442973.1_5 Forward -332 -313 9.73422 0.296
NP_441486.1_1 Forward -141 -127 5.50613 0.0365
NP_441486.1_1 Reverse -126 -140 3.44117 0.0597
NP_441486.1_1 Forward -127 -113 0.491246 0.134
NP_442634.1_4 Reverse -213 -227 -5.60527 0.264
NP_442634.1_4 Forward -226 -212 -6.09693 0.299
NP_440842.1_10 Forward -359 -345 4.22782 0.254
NP_442848.1_1 Forward -144 -130 -4.4253 0.291
NP_441012.1_4 Reverse -273 -286 5.42749 0.297
NP_441634.1_8 Reverse -269 -283 2.65453 0.166
NP_440376.1_1 Reverse -296 -305 1.37636 0.252
NP_441588.1_4 Reverse -131 -141 6.46988 0.193
NP_441588.1_4 Forward -86 -76 5.68323 0.245
NP_440642.1_10 Forward -108 -94 2.45727 0.277
NP_441013.1_2 Forward -285 -267 -2.93078 0.287
NP_441013.1_3 Forward -367 -348 7.57094 0.266
NP_442720.1_9 Forward -284 -265 13.9625 0.0944
NP_440141.1_8 Reverse -38 -57 6.19431 0.268
NP_442782.1_2 Forward -183 -169 2.2612 0.275
NP_442782.1_2 Forward -367 -353 1.76955 0.281
NP_442205.1_9 Forward -230 -214 16.1848 0.0259
NP_442205.1_9 Reverse -209 -225 -0.629782 0.264
NP_442937.1_5 Reverse -110 -129 8.45592 0.22
NP_442937.1_5 Forward -279 -260 6.19431 0.286
NP_441317.1_4 Reverse -319 -333 10.2279 0.29
NP_441127.1_1 Reverse -209 -223 9.73436 0.268
NP_441127.1_5 Forward -186 -167 12.8913 0.274
NP_439905.1_1 Forward -192 -179 7.59077 0.255
NP_442376.1_2 Reverse -281 -300 -13.1769 0.286
NP_442376.1_6 Reverse -310 -329 2.3594 0.295
NP_442911.1_2 Reverse -255 -274 -10.0303 0.268
NP_440153.1_5 Reverse -216 -230 0.589577 0.297
NP_442064.1_4 Forward -222 -203 6.98015 0.246
NP_442064.1_4 Forward -284 -265 6.68515 0.246
NP_442536.1_7 Reverse -209 -228 7.7676 0.273
NP_440138.1_6 Reverse -6 -25 13.0766 0.109
NP_443044.1_1 Forward -389 -370 3.73603 0.283
NP_441348.1_3 Reverse -266 -285 11.2092 0.176
NP_442567.1_3 Reverse -186 -202 12.1532 0.275
NP_442598.1_2 Reverse -316 -325 14.5527 0.252
NP_442885.1_4 Reverse -320 -333 17.964 0.217
NP_440377.1_1 Reverse -174 -191 11.0804 0.291
NP_440147.1_4 Reverse -168 -181 1.69091 0.222
NP_440147.1_4 Forward -276 -263 1.59258 0.224
NP_441175.1_7 Reverse -183 -202 13.2741 0.113
NP_441295.1_6 Reverse -193 -212 9.93088 0.246
NP_441550.1_8 Forward -226 -216 6.56775 0.201
NP_441550.1_8 Reverse -213 -223 5.38779 0.252
NP_441041.1_4 Reverse -265 -284 -12.8819 0.276
NP_440703.1_9 Reverse -271 -284 6.0169 0.288
NP_441725.1_4 Forward -349 -335 2.75226 0.279
NP_439966.1_4 Forward -186 -167 15.8307 0.103
NP_442941.1_3 Forward -223 -213 7.84651 0.0564
NP_442941.1_3 Reverse -130 -140 -0.609952 0.264
NP_440260.1_8 Forward -221 -203 -6.76569 0.295
NP_441334.1_7 Forward -226 -207 -20.3551 0.275
NP_441457.1_9 Reverse -153 -172 11.1109 0.251
NP_442288.1_3 Reverse -147 -164 11.2486 0.197
NP_441644.1_6 Reverse -215 -225 3.51951 0.277
NP_442215.1_2 Reverse -127 -143 -6.43131 0.271
NP_442029.1_1 Reverse -179 -198 -20.4534 0.298
NP_442029.1_6 Reverse -266 -285 11.6025 0.158
NP_440929.1_8 Forward -88 -79 2.458 0.255
NP_441751.2_8 Forward -223 -209 -5.50694 0.214
NP_441751.2_8 Forward -290 -276 -6.58858 0.273
NP_442554.1_8 Forward -279 -269 4.20827 0.193
NP_442142.1_4 Forward -17 -4 3.85363 0.243
NP_442292.1_1 Reverse -130 -139 -0.295266 0.24
NP_442292.1_5 Reverse -93 -112 -1.37718 0.262
NP_440421.1_1 Forward -81 -67 13.7659 0.295
NP_441715.1_4 Forward -223 -213 4.99491 0.24
NP_440279.1_2 Forward -25 -6 9.3409 0.179
NP_441448.1_1 Reverse -77 -96 4.916 0.268
NP_441618.1_10 Reverse -260 -279 9.43923 0.294
NP_441020.2_6 Reverse -105 -122 6.23369 0.27
NP_441015.1_10 Reverse -266 -285 -9.24366 0.281
NP_441673.1_1 Reverse -129 -138 -8.06341 0.254
NP_441826.1_2 Forward -20 -6 6.58777 0.0916
NP_441826.1_2 Reverse -209 -223 -4.81863 0.3
NP_441826.1_5 Reverse -272 -291 0.884433 0.298
NP_442490.1_9 Reverse -265 -284 -7.96535 0.282
NP_441251.1_7 Reverse -332 -345 15.9489 0.266
NP_442559.1_3 Forward -283 -264 9.24257 0.28
NP_442227.1_2 Reverse -354 -373 1.17943 0.25
NP_442227.1_2 Reverse -351 -370 -2.85214 0.283
NP_442427.1_8 Reverse -330 -349 11.2092 0.152
NP_440145.1_3 Reverse -119 -138 9.73422 0.0433
NP_442050.1_1 Forward -368 -349 14.1591 0.187
NP_442050.1_5 Forward -90 -80 7.55106 0.251
NP_440038.1_4 Reverse -344 -363 3.04771 0.275
NP_440342.1_1 Forward -365 -346 13.7658 0.207
NP_440346.1_6 Forward -265 -255 14.4388 0.273
NP_441114.1_3 Forward -122 -113 7.37455 0.239
NP_440558.1_2 Forward -110 -91 3.24438 0.159
NP_440558.1_2 Forward -221 -202 -5.70374 0.264
NP_441518.1_3 Forward -98 -79 -15.0452 0.286
NP_441878.1_6 Forward -281 -271 -0.118297 0.167
NP_441878.1_6 Reverse -264 -274 -7.59145 0.245
NP_441557.1_5 Forward -138 -129 -0.68859 0.229
NP_442267.1_4 Reverse -269 -288 6.4893 0.17
NP_441308.1_8 Reverse -213 -223 9.22315 0.226
NP_440101.1_3 Forward -229 -210 22.1239 0.0157
NP_440101.1_10 Reverse -346 -365 8.55425 0.182
NP_441564.1_2 Reverse -281 -300 3.93269 0.119
NP_442183.1_3 Reverse -55 -74 21.7297 0.0371
NP_442166.1_3 Reverse -369 -388 -3.54046 0.264
NP_441574.1_1 Forward -233 -214 -6.09707 0.273
NP_442965.1_2 Reverse -98 -117 -6.58872 0.257
NP_442888.1_6 Reverse -173 -192 1.47442 0.288
NP_442594.1_8 Reverse -113 -132 6.98095 0.215
NP_442594.1_8 Reverse -279 -298 5.30933 0.247
NP_442594.1_8 Reverse -274 -293 4.71934 0.259
NP_441633.1_3 Reverse -3 -16 0.117615 0.132
NP_441633.1_3 Forward -108 -95 -5.58558 0.236
NP_440136.1_2 Reverse -130 -137 4.26735 0.218
NP_442998.1_5 Reverse -370 -380 10.7964 0.204
NP_440299.1_1 Forward -278 -265 3.7553 0.232
NP_440299.1_6 Reverse -144 -163 10.3242 0.208
NP_441799.1_1 Forward -120 -106 4.12889 0.266
NP_441007.1_10 Forward -229 -216 2.18257 0.195
NP_440256.1_1 Reverse -167 -186 -9.93197 0.291
NP_440256.1_1 Reverse -187 -206 -10.3253 0.299
NP_442961.1_7 Reverse -216 -235 7.17762 0.289
NP_441559.1_8 Forward -111 -97 -7.08024 0.283
NP_441296.1_8 Reverse -5 -24 14.0608 0.258
NP_440134.1_3 Reverse -185 -204 10.3242 0.112
NP_442866.1_1 Forward -229 -210 -5.11376 0.24
NP_441464.1_8 Reverse -53 -67 6.48943 0.232
NP_441464.1_8 Forward -274 -260 5.70279 0.253
NP_440702.1_10 Forward -229 -210 24.5822 0.00327
NP_442993.1_1 Forward -88 -72 -6.82463 0.146
NP_442993.1_1 Reverse -352 -368 -9.77456 0.194
NP_442386.1_9 Reverse -128 -137 11.209 0.0993
NP_442386.1_9 Forward -89 -80 6.68581 0.219
NP_441340.1_5 Reverse -80 -87 3.97235 0.274
NP_442484.1_2 Forward -285 -266 6.39097 0.156
NP_440168.1_9 Forward -73 -54 2.65439 0.231
NP_440327.1_6 Reverse -104 -123 3.24438 0.285
NP_442714.1_7 Forward -106 -87 2.94938 0.208
NP_440586.1_4 Forward -369 -351 12.9005 0.25
NP_440586.1_8 Forward -87 -80 5.8403 0.283
NP_440586.1_9 Forward -372 -353 9.3409 0.261
NP_443051.1_1 Reverse -214 -223 -0.000272808 0.245
NP_439937.1_9 Forward -108 -91 -0.0601847 0.109
NP_440836.1_6 Reverse -315 -329 10.6193 0.242
NP_440398.1_2 Forward -236 -217 3.93269 0.231
NP_440372.1_2 Reverse -80 -87 4.26735 0.221
NP_440171.1_3 Forward -371 -352 2.94938 0.284
NP_441789.1_7 Forward -300 -281 -5.40949 0.298
NP_440819.1_5 Reverse -369 -377 7.98423 0.228
NP_440819.1_5 Reverse -370 -378 7.68924 0.266
NP_440267.1_2 Reverse -227 -241 9.83206 0.156
NP_442887.1_5 Forward -288 -269 -12.6852 0.281
NP_442384.1_10 Forward -361 -348 6.4108 0.102
NP_442384.1_10 Forward -179 -166 1.10092 0.268
NP_442790.1_4 Forward -367 -348 -11.6036 0.231
NP_441814.1_5 Reverse -195 -214 11.7008 0.186
NP_440531.1_6 Forward -132 -113 -2.26216 0.247
NP_440531.1_6 Forward -146 -127 -2.75381 0.258
NP_440531.1_8 Reverse -281 -300 8.55425 0.216
NP_442065.1_7 Forward -147 -129 2.67408 0.215
NP_442693.1_6 Reverse -56 -75 1.67108 0.278
NP_440297.1_9 Forward -279 -269 -0.216628 0.282
NP_442280.1_10 Forward -284 -266 17.0451 0.0964
NP_442280.1_10 Reverse -12 -30 4.77262 0.294
NP_441896.1_3 Reverse -174 -193 -3.14714 0.297
NP_440894.1_4 Forward -348 -329 3.83436 0.219
NP_440894.1_7 Reverse -78 -97 10.2251 0.241
NP_440894.1_10 Reverse -27 -46 15.6341 0.0815
NP_440999.1_9 Forward -228 -214 -3.147 0.287
NP_440999.1_9 Forward -306 -292 -3.54032 0.296
NP_442845.1_2 Reverse -265 -279 5.01447 0.247
NP_440208.1_1 Reverse -167 -186 0.58944 0.119
NP_441469.1_8 Forward -306 -297 9.73449 0.227
NP_440516.1_6 Reverse -63 -77 6.98048 0.285
NP_440783.1_2 Forward -291 -272 -3.54046 0.211
NP_442859.1_2 Forward -223 -204 5.211 0.21
NP_440673.1_3 Forward -122 -115 8.98723 0.203
NP_440673.1_3 Reverse -40 -47 7.80726 0.244
NP_442219.1_8 Reverse -208 -227 13.9651 0.149
NP_442219.1_8 Forward -222 -203 10.4863 0.203
NP_442219.1_9 Forward -137 -128 12.5861 0.032
NP_440436.1_4 Forward -123 -114 7.76745 0.124
NP_441004.1_1 Reverse -197 -216 -6.68705 0.19
NP_441004.1_1 Reverse -165 -184 -14.0619 0.263
NP_441004.1_3 Reverse -187 -206 1.57275 0.292
NP_441004.1_4 Reverse -95 -105 9.02648 0.259
NP_441004.1_4 Reverse -168 -178 7.74818 0.289
NP_442873.1_5 Reverse -55 -74 7.57013 0.276
NP_442206.1_10 Reverse -277 -292 0.864876 0.243
NP_440328.1_4 Reverse -209 -228 1.86774 0.213
NP_441966.1_7 Forward -210 -191 10.6184 0.152
NP_441851.1_10 Forward -139 -129 5.5849 0.207
NP_441982.1_6 Reverse -179 -188 10.5755 0.295
NP_441046.1_2 Forward -366 -347 -1.67217 0.292
NP_441409.1_6 Forward -224 -205 -10.0303 0.198
NP_440389.1_2 Forward -229 -210 11.4058 0.287
NP_440432.1_9 Reverse -309 -324 -5.32998 0.245
NP_442843.1_1 Reverse -80 -99 -1.27885 0.192
NP_440474.1_8 Reverse -216 -230 7.3738 0.207
NP_440396.1_1 Forward -103 -84 -2.95047 0.228
NP_441477.1_5 Forward -278 -259 6.68596 0.278
NP_442006.1_3 Forward -369 -351 -7.94566 0.298
NP_443047.1_7 Forward -290 -271 4.03102 0.271
NP_442243.1_1 Forward -286 -268 2.08335 0.204
NP_441570.1_1 Reverse -79 -97 -10.6989 0.177
NP_441570.1_1 Reverse -129 -147 -16.7954 0.254
NP_442729.1_5 Reverse -208 -218 8.73149 0.248
NP_442443.1_1 Forward -268 -249 -0.197208 0.222
NP_442443.1_1 Reverse -167 -186 -5.11376 0.281
NP_441432.1_8 Reverse -114 -123 5.40793 0.158
NP_441432.1_8 Forward -139 -130 4.42462 0.213
NP_441432.1_8 Reverse -214 -223 3.93297 0.243
NP_441732.1_2 Reverse -211 -227 -15.5761 0.151
NP_440629.1_4 Forward -398 -379 8.16093 0.271
NP_442274.1_8 Forward -219 -201 13.4743 0.286
NP_440199.1_10 Reverse -212 -222 10.1081 0.186
NP_441057.1_3 Forward -187 -168 -11.4069 0.231
NP_441072.1_2 Forward -149 -130 11.2092 0.188
NP_441072.1_2 Reverse -68 -87 6.39097 0.28
NP_440559.1_1 Reverse -80 -89 4.22796 0.292
NP_441040.1_2 Forward -188 -169 2.3594 0.119
NP_441800.1_3 Reverse -198 -216 5.52568 0.286
NP_442346.1_5 Reverse -114 -124 11.2881 0.0706
NP_442346.1_5 Reverse -214 -224 7.25653 0.176
NP_442346.1_5 Reverse -4 -14 6.56821 0.198
NP_440545.1_3 Reverse -94 -111 -5.36936 0.247
NP_440459.1_2 Forward -289 -272 12.9202 0.133
NP_440459.1_2 Reverse -262 -279 9.97027 0.212
NP_441943.1_8 Forward -282 -263 -5.80207 0.261
NP_441585.1_2 Reverse -337 -356 14.7491 0.254
NP_441888.1_7 Forward -285 -271 5.30946 0.225
NP_441895.1_2 Forward -373 -354 -16.9135 0.168
NP_441112.1_6 Forward -134 -115 -4.42544 0.297
NP_442162.1_9 Forward -87 -80 3.4807 0.246
NP_442162.1_9 Reverse -80 -87 3.38237 0.276
NP_440671.1_4 Reverse -209 -223 5.21113 0.289
NP_440671.1_4 Reverse -73 -87 5.1128 0.292
NP_440875.1_9 Reverse -100 -110 8.46937 0.233
NP_440875.1_9 Reverse -273 -283 7.59334 0.255
NP_441813.1_5 Forward -90 -80 4.79825 0.144
NP_440821.1_7 Reverse -49 -68 8.45592 0.288
NP_441239.1_9 Forward -282 -270 13.3137 0.037
NP_441239.1_9 Forward -358 -346 3.87389 0.272
NP_441892.1_1 Reverse -206 -223 1.21881 0.155
NP_441892.1_1 Forward -23 -6 -2.02611 0.217
NP_442193.1_8 Forward -364 -345 13.3716 0.214
NP_441508.1_4 Forward -328 -314 12.9985 0.298
NP_440949.1_3 Forward -263 -244 10.1275 0.226
NP_442138.1_1 Reverse -350 -369 4.91521 0.24
NP_441656.1_6 Forward -113 -94 9.3409 0.195
NP_442340.1_3 Reverse -40 -59 -10.0303 0.278
NP_442499.1_1 Forward -279 -260 7.86593 0.203
NP_442787.1_9 Reverse -320 -339 13.7658 0.296
NP_440374.1_1 Forward -230 -211 12.1925 0.248
NP_441474.1_1 Reverse -350 -369 -2.36125 0.275
NP_442840.1_7 Reverse -183 -202 13.0775 0.0728
NP_440341.1_1 Forward -66 -47 5.30933 0.23
NP_442402.1_4 Forward -186 -167 -6.3928 0.257
NP_440696.1_3 Forward -66 -48 -1.45582 0.259
NP_442358.1_6 Reverse -204 -222 7.68896 0.294
NP_440825.1_6 Reverse -105 -124 15.9291 0.218
NP_440160.1_3 Forward -209 -190 7.66846 0.284
NP_440505.1_3 Forward -74 -64 6.76487 0.169
NP_441252.1_6 Forward -186 -179 11.6422 0.288
NP_442532.1_7 Reverse -215 -229 11.996 0.114
NP_440914.1_1 Reverse -129 -139 9.00547 0.186
NP_441011.1_8 Forward -157 -148 8.06287 0.16
NP_442533.1_6 Forward -355 -346 10.5211 0.0538
NP_442533.1_6 Forward -138 -129 5.11294 0.155
NP_442533.1_6 Reverse -271 -280 4.52295 0.179
NP_442533.1_6 Forward -14 -5 3.63797 0.206
NP_442533.1_6 Reverse -352 -361 3.53964 0.21
NP_442541.1_10 Forward -280 -266 2.65393 0.254
NP_440263.1_2 Reverse -350 -369 14.3549 0.276
NP_441482.1_7 Reverse -209 -223 -11.2101 0.245
NP_441482.1_7 Forward -20 -6 -11.3085 0.254
NP_441028.1_6 Forward -378 -368 12.6642 0.183
NP_441028.1_6 Forward -377 -367 5.78111 0.243
NP_441028.1_6 Reverse -361 -371 3.8145 0.281
NP_440007.1_9 Reverse -211 -225 12.0943 0.163
NP_441059.1_2 Reverse -190 -209 -6.58872 0.268
NP_441544.1_1 Forward -109 -97 19.9018 0.125
NP_441972.1_5 Reverse -6 -25 -2.65548 0.187
NP_440886.1_7 Reverse -135 -145 6.86274 0.113
NP_440886.1_7 Reverse -351 -361 6.56775 0.118
NP_442614.1_2 Forward -358 -344 6.29277 0.291
NP_441399.1_6 Reverse -11 -30 15.1416 0.185
NP_442072.1_1 Forward -199 -181 5.72234 0.289
NP_440513.1_2 Forward -362 -343 16.1257 0.295
NP_442800.1_7 Reverse -179 -198 6.88262 0.219
NP_441021.1_1 Forward -123 -104 -12.3902 0.286
NP_441962.1_4 Reverse -93 -112 -5.80207 0.174
NP_441962.1_4 Forward -61 -42 -10.227 0.224
NP_440387.1_5 Forward -289 -270 14.402 0.26
NP_440855.1_2 Forward -214 -195 15.8299 0.263
NP_440855.1_5 Forward -220 -201 2.35861 0.295
NP_441431.1_2 Reverse -104 -118 7.86545 0.231
NP_441431.1_2 Forward -17 -3 5.70218 0.291
NP_441193.1_6 Reverse -116 -135 13.1758 0.0607
NP_442084.1_6 Reverse -200 -218 4.54237 0.29
NP_440467.1_3 Forward -106 -87 13.5024 0.19
NP_441817.1_7 Reverse -278 -297 15.0441 0.265
NP_442698.1_10 Forward -60 -41 -1.37718 0.299
NP_440293.1_9 Forward -285 -271 11.3443 0.257
NP_441237.1_9 Reverse -130 -140 10.8948 0.214
NP_439910.1_2 Reverse -71 -88 -21.889 0.195
NP_439910.1_2 Reverse -121 -138 -22.3806 0.232
NP_440457.1_1 Reverse -273 -285 -1.04266 0.289
NP_441981.1_8 Forward -262 -248 13.8643 0.261
NP_441984.1_3 Forward -291 -273 10.3439 0.187
NP_441253.1_7 Forward -172 -154 6.31233 0.276
NP_442936.1_10 Reverse -373 -387 12.0393 0.226
NP_442514.1_5 Forward -287 -268 4.42355 0.157
NP_442514.1_5 Reverse -356 -375 -3.83621 0.234
NP_442514.1_5 Forward -220 -201 -5.1145 0.254
NP_440554.1_4 Forward -87 -77 4.3066 0.195
NP_440554.1_4 Forward -115 -105 1.74999 0.29
NP_442862.1_3 Forward -345 -328 9.57695 0.219
NP_442862.1_3 Reverse -330 -347 7.80699 0.253
NP_441885.1_5 Forward -138 -128 7.84651 0.0419
NP_442128.1_6 Forward -336 -322 13.6676 0.29
NP_441428.1_8 Forward -313 -294 5.50599 0.226
NP_442341.1_7 Forward -275 -261 4.03116 0.204
NP_441173.1_9 Forward -377 -369 9.75379 0.284
NP_440423.1_6 Reverse -71 -90 -12.6852 0.198
NP_443000.1_7 Reverse -213 -223 11.7798 0.0344
NP_440507.2_3 Forward -23 -4 8.06178 0.261
NP_440091.1_1 Reverse -75 -87 1.31728 0.198
NP_441307.1_4 Reverse -284 -303 3.34271 0.218
NP_443060.1_1 Forward -338 -319 8.4551 0.276
NP_442354.1_8 Reverse -317 -336 11.0125 0.243
NP_442354.1_8 Reverse -161 -180 8.84924 0.266
NP_439962.1_4 Reverse -348 -367 -6.29373 0.283
NP_440175.1_4 Reverse -263 -282 -0.787193 0.122
NP_442214.1_1 Reverse -191 -210 12.5858 0.218
NP_441105.1_3 Reverse -204 -223 -1.18052 0.147
NP_440216.1_9 Reverse -99 -108 10.9145 0.286
NP_440216.1_9 Forward -122 -113 5.50626 0.292
NP_440172.1_1 Forward -14 -4 1.74999 0.299
NP_442015.1_10 Forward -284 -271 2.18257 0.199
NP_442015.1_10 Forward -110 -97 -0.570702 0.272
NP_441226.1_1 Forward -181 -167 16.0269 0.274
NP_441226.1_7 Forward -87 -80 8.59356 0.197
NP_441111.1_7 Reverse -130 -138 -0.472234 0.131
NP_441766.1_2 Forward -88 -79 3.63797 0.209
NP_440416.1_9 Reverse -345 -364 -18.3884 0.256
NP_440416.1_9 Forward -281 -262 -20.4534 0.285
NP_442116.1_6 Reverse -329 -346 6.73658 0.271
NP_442154.1_1 Forward -73 -55 -11.4856 0.215
NP_442564.1_10 Reverse -363 -377 14.9459 0.244
NP_442046.1_2 Reverse -375 -388 14.8617 0.262
NP_440261.1_5 Forward -105 -92 -6.56889 0.201
NP_440261.1_5 Reverse -6 -19 -12.4687 0.297
NP_440261.1_7 Reverse -364 -383 -6.68705 0.283
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCCAGCAGGACTAAAAATACTTTTTCCCCGGGTGGAAAGTGGTGGCCGGGCCCAATTAGTCCAAGAATTGAGCCAAAAACAAGCCTTGGTTACGGAAGTCCCCTCCTATCAATCCGCCTGCCCTGGCCATATGCCCGAAGAAGTGTGGCAAAGTATCGTTAATCAAACGGTGGATGTGATCACCTTTGCCAGTTCCAAAACCGTCAGCCATTTTCGGCAACTGTTGGCCCAGACTAGCCAAGCTAACGGTTACCAAGATTGGCGTTCCCTAATTAACCATTGCCAAATCGCTTCCATTGGCCCCCAAACTTCCGAACGCTGTTTACGGGAATTGGGTCGGGTGGACATTGAAGCAACGGAGTACACCCTAGAAGGCCTAACCGGGGCCATTACTAATT

CDS

ATGTTTACCAAAATCCGTGACCTTGCCTCTCCATTGCCATTGATGGCGGCCATGGCCGCCTTGGGGGGGATGCTGTTTGCCCCCGTCGTCCGTAGCCAAGAGACAATTTTTCAAGAAAGTGTCCAAAGCCAAACCACCTTTGCAGCTCAGCAATGTTCAGTCAAACTCACCGATCCCAGTGAAGAAATGGCCATGGACTGTAATCAGCTTTCCATCACGGAGGGGGACGGCACTATTAATTTCCACTACGACGATGGCGATGTCATGGGTTTTTCTTTCGTGCTGGAATACAATGACGACCCCATACTGGTCAATGGCAAAATCAATAGCAATCAGTACAATGTCATTGGTACTTTTCTCTGGACTGCGGAAGATGGCATTGTTGACGAAACTTTAACGGAGGCCACAGGGAACTGTCGGGCCACCCCAGCCCAGGTGGTTTGTCAGGCTACCATTGACAACACCATGAAGGTGGAAGCGGTGGTGGATTTCTAG

Protein

MFTKIRDLASPLPLMAAMAALGGMLFAPVVRSQETIFQESVQSQTTFAAQQCSVKLTDPSEEMAMDCNQLSITEGDGTINFHYDDGDVMGFSFVLEYNDDPILVNGKINSNQYNVIGTFLWTAEDGIVDETLTEATGNCRATPAQVVCQATIDNTMKVEAVVDF