Your browser is old and dusty. Try Google Chrome!

Details for sll0157

ORF sll0157
Accession NP_442004.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -114 -128 8.55439 0.0865
NP_440795.1_7 Forward -121 -114 14.6904 0.0123
NP_440795.1_7 Reverse -114 -121 14.6904 0.0123
NP_441418.1_6 Reverse -113 -132 -0.4922 0.0102
NP_441418.1_6 Reverse -294 -313 -30.5815 0.286
NP_442291.1_5 Forward -123 -107 1.63183 0.142
NP_440897.1_6 Forward -122 -103 -2.65624 0.219
NP_441453.1_1 Forward -129 -111 3.65664 0.263
NP_441453.1_4 Reverse -113 -121 16.539 0.00633
NP_441453.1_4 Forward -122 -114 16.539 0.00633
NP_441623.1_1 Forward -310 -292 -1.35749 0.24
NP_441623.1_1 Reverse -277 -295 -2.0458 0.241
NP_442151.1_6 Reverse -113 -127 10.816 0.114
NP_442151.1_6 Forward -122 -108 6.78443 0.221
NP_441818.1_1 Forward -121 -110 9.79292 0.232
NP_441818.1_1 Reverse -114 -125 9.69459 0.232
NP_441818.1_9 Forward -278 -259 -3.24547 0.221
NP_441818.1_9 Reverse -102 -121 -9.14533 0.287
NP_441465.1_8 Forward -133 -115 18.3087 0.0785
NP_440259.1_4 Forward -176 -162 10.4676 0.262
NP_441098.1_3 Reverse -380 -399 1.82439 0.25
NP_440996.1_3 Forward -196 -178 14.9655 0.166
NP_442173.1_1 Forward -121 -113 15.4574 0.00633
NP_442173.1_1 Reverse -114 -122 15.4574 0.00633
NP_442752.1_4 Forward -122 -115 13.8055 0.0199
NP_442752.1_4 Reverse -113 -120 13.8055 0.0199
NP_443027.1_4 Forward -124 -114 14.828 0.0437
NP_441812.1_3 Reverse -112 -126 9.14437 0.245
NP_442975.1_10 Forward -126 -112 22.615 0.000219
NP_442975.1_10 Forward -320 -306 2.16228 0.283
NP_440784.1_7 Forward -121 -114 15.9687 0.0123
NP_440784.1_7 Reverse -114 -121 15.9687 0.0123
NP_442909.1_7 Forward -121 -107 12.5853 0.131
NP_441250.1_3 Forward -194 -175 14.7491 0.131
NP_440061.1_9 Forward -124 -110 11.7987 0.105
NP_440110.1_8 Reverse -111 -130 11.0125 0.0878
NP_441476.1_5 Forward -127 -108 -2.95047 0.231
NP_442062.1_2 Reverse -102 -121 16.6174 0.244
NP_442062.1_8 Reverse -113 -123 19.4496 0.000558
NP_442062.1_8 Forward -122 -112 17.3846 0.00193
NP_442062.1_8 Reverse -294 -304 4.60159 0.206
NP_440304.1_4 Forward -124 -114 10.8948 0.051
NP_440304.1_4 Reverse -111 -121 1.84832 0.299
NP_442242.1_4 Forward -121 -114 14.3954 0.0124
NP_442242.1_4 Reverse -114 -121 14.3954 0.0124
NP_440044.1_8 Forward -121 -102 17.7974 0.0183
NP_440044.1_8 Reverse -114 -133 3.44104 0.13
NP_441781.1_7 Forward -122 -103 -1.96717 0.285
NP_441581.1_6 Forward -131 -112 11.2316 0.283
NP_440916.1_1 Forward -318 -304 10.521 0.206
NP_439918.1_2 Reverse -55 -74 -3.04881 0.251
NP_439918.1_2 Reverse -108 -127 -4.91709 0.291
NP_441208.1_9 Reverse -110 -124 13.7659 0.103
NP_441594.1_6 Forward -131 -112 8.84924 0.153
NP_440370.1_10 Reverse -104 -123 10.6192 0.2
NP_442110.1_7 Reverse -113 -127 11.701 0.0593
NP_442110.1_7 Forward -122 -108 -0.492064 0.291
NP_441925.1_4 Forward -115 -96 -16.3242 0.282
NP_441925.1_4 Reverse -260 -279 -17.5041 0.296
NP_441083.1_5 Forward -122 -112 20.3345 0.00053
NP_441083.1_5 Reverse -113 -123 11.3864 0.0159
NP_441083.1_5 Reverse -208 -218 3.12662 0.182
NP_442827.1_8 Forward -311 -292 1.08032 0.188
NP_442827.1_8 Forward -130 -111 -0.886293 0.236
NP_441149.1_7 Forward -117 -98 2.45773 0.271
NP_441434.1_3 Forward -186 -167 -1.27885 0.245
NP_441738.1_2 Forward -120 -113 15.28 0.0102
NP_441738.1_2 Reverse -115 -122 15.28 0.0102
NP_440209.1_1 Reverse -113 -121 18.1123 0.00295
NP_440209.1_1 Forward -122 -114 18.1123 0.00295
NP_442136.1_1 Forward -54 -35 15.9291 0.0982
NP_442889.1_1 Reverse -90 -109 -14.1602 0.272
NP_442889.1_8 Forward -125 -111 22.615 0.00144
NP_441713.1_1 Forward -128 -109 -15.5368 0.265
NP_441770.1_10 Reverse -292 -311 21.1406 0.083
NP_440178.1_7 Forward -123 -104 -21.535 0.229
NP_442570.1_3 Reverse -105 -124 -1.27885 0.212
NP_442570.1_3 Reverse -111 -130 -5.01543 0.237
NP_441792.1_5 Forward -111 -95 16.2831 0.153
NP_441716.1_1 Forward -122 -108 6.98109 0.183
NP_442111.1_4 Reverse -112 -126 10.7177 0.0518
NP_440906.1_5 Forward -121 -114 15.8704 0.0124
NP_440906.1_5 Reverse -114 -121 15.8704 0.0124
NP_440012.1_6 Reverse -102 -121 10.5209 0.247
NP_440747.1_10 Reverse -110 -122 14.9853 0.00221
NP_440747.1_10 Forward -125 -113 -2.02597 0.0196
NP_441130.1_10 Forward -124 -110 11.5043 0.106
NP_441486.1_1 Forward -125 -111 22.5174 0.00162
NP_441486.1_1 Reverse -110 -124 19.9608 0.00312
NP_442330.1_4 Reverse -158 -177 16.1172 0.233
NP_442760.1_7 Reverse -168 -187 10.6192 0.198
NP_440403.1_4 Forward -131 -112 -3.93378 0.203
NP_440403.1_10 Forward -131 -112 8.84924 0.189
NP_440403.1_10 Reverse -292 -311 3.6377 0.273
NP_440842.1_10 Forward -313 -299 1.67122 0.286
NP_441014.1_8 Forward -309 -290 -9.24366 0.293
NP_441014.1_10 Reverse -112 -131 15.2399 0.0655
NP_442848.1_1 Reverse -107 -121 5.80112 0.0803
NP_442848.1_1 Forward -128 -114 -2.55701 0.263
NP_442848.1_9 Forward -137 -118 8.45592 0.182
NP_443018.1_3 Forward -121 -114 14.8871 0.0123
NP_443018.1_3 Reverse -114 -121 14.8871 0.0123
NP_443018.1_3 Reverse -295 -302 7.6106 0.156
NP_441634.1_8 Reverse -111 -125 5.1128 0.114
NP_441634.1_8 Reverse -123 -137 -3.93365 0.295
NP_440376.1_1 Forward -122 -113 19.4693 0.000692
NP_440376.1_1 Reverse -113 -122 19.4693 0.000692
NP_440376.1_1 Forward -303 -294 2.75299 0.215
NP_440376.1_1 Forward -217 -208 1.47469 0.251
NP_441588.1_4 Forward -120 -110 8.92815 0.14
NP_441588.1_4 Reverse -115 -125 6.96153 0.178
NP_442687.1_7 Forward -123 -113 15.8113 0.0125
NP_442687.1_7 Forward -338 -328 11.7798 0.0959
NP_442687.1_7 Reverse -112 -122 8.92815 0.0994
NP_442687.1_7 Forward -304 -294 4.10993 0.266
NP_442191.1_4 Reverse -114 -128 15.3562 0.0603
NP_442485.1_3 Forward -133 -114 3.6377 0.195
NP_441846.1_10 Forward -277 -258 -13.2752 0.201
NP_442530.1_2 Forward -95 -85 13.5497 0.239
NP_440642.1_10 Forward -156 -142 6.98048 0.224
NP_441013.1_2 Reverse -336 -354 4.83737 0.222
NP_441422.1_7 Forward -124 -107 -3.30441 0.233
NP_441422.1_7 Reverse -262 -279 -8.31929 0.268
NP_441950.1_7 Forward -281 -262 -8.752 0.287
NP_442296.1_9 Forward -32 -13 -5.80207 0.293
NP_442658.1_1 Forward -124 -114 15.9091 0.00966
NP_442658.1_1 Reverse -111 -121 6.76441 0.214
NP_442658.1_1 Forward -305 -295 6.56775 0.224
NP_440141.1_8 Forward -312 -293 7.96426 0.232
NP_440656.1_8 Forward -133 -114 -8.65367 0.273
NP_441414.1_9 Forward -122 -103 -10.6203 0.29
NP_441478.1_10 Forward -174 -156 8.57317 0.211
NP_442937.1_5 Reverse -108 -127 6.4893 0.278
NP_441958.1_5 Forward -123 -113 12.2714 0.00183
NP_441958.1_5 Reverse -112 -122 12.2714 0.00183
NP_441127.1_1 Forward -303 -289 9.93102 0.267
NP_440203.1_5 Forward -119 -109 9.71433 0.245
NP_439990.1_5 Reverse -12 -25 9.36073 0.145
NP_442376.1_2 Forward -31 -12 -10.6203 0.286
NP_442911.1_2 Forward -132 -113 -8.55534 0.237
NP_441580.1_6 Forward -133 -114 2.3594 0.117
NP_440153.1_5 Reverse -114 -128 1.67122 0.245
NP_442536.1_4 Reverse -168 -186 6.80398 0.299
NP_443055.1_3 Forward -131 -112 10.7406 0.28
NP_443055.1_6 Reverse -105 -123 -0.473239 0.261
NP_442236.1_7 Reverse -106 -125 9.3409 0.253
NP_440496.1_1 Forward -20 -1 4.42435 0.266
NP_440388.1_7 Reverse -50 -69 1.27776 0.251
NP_440602.1_8 Reverse -113 -127 9.5377 0.298
NP_440138.1_6 Forward -127 -108 4.71854 0.237
NP_441099.1_5 Reverse -103 -122 -11.8003 0.29
NP_442002.1_9 Forward -123 -116 10.7572 0.185
NP_440809.1_2 Forward -295 -276 -0.590531 0.177
NP_441294.1_7 Forward -126 -112 15.9698 0.0176
NP_441294.1_7 Reverse -109 -123 11.2664 0.15
NP_441294.1_7 Forward -30 -16 9.73057 0.229
NP_441646.1_1 Forward -222 -203 3.24438 0.207
NP_442438.1_10 Forward -127 -113 16.5192 0.0212
NP_442438.1_10 Reverse -108 -122 12.291 0.0412
NP_442431.1_10 Forward -275 -257 1.59244 0.251
NP_441000.1_6 Forward -123 -109 3.24451 0.116
NP_441000.1_6 Reverse -112 -126 -3.44199 0.221
NP_441674.1_6 Forward -121 -102 2.65439 0.275
NP_441674.1_10 Forward -137 -119 -0.669169 0.29
NP_440147.1_3 Reverse -286 -305 1.47442 0.3
NP_440147.1_4 Reverse -111 -124 10.049 0.0355
NP_440147.1_4 Forward -124 -111 3.46087 0.187
NP_441550.1_8 Reverse -111 -121 14.6309 0.0132
NP_441550.1_8 Forward -124 -114 6.0761 0.214
NP_441550.1_8 Reverse -292 -302 5.87944 0.224
NP_441916.1_7 Reverse -113 -123 18.4663 0.00144
NP_441916.1_7 Forward -122 -112 10.3048 0.0261
NP_440465.1_10 Forward -218 -199 -0.0988766 0.29
NP_441041.1_4 Reverse -113 -132 -3.04881 0.119
NP_441041.1_4 Forward -122 -103 -11.4069 0.246
NP_441041.1_7 Forward -125 -113 10.916 0.0864
NP_442396.1_5 Reverse -109 -122 10.7374 0.106
NP_442004.1_2 Forward -310 -291 20.375 0.132
NP_442004.1_6 Forward -122 -108 18.0925 0.0534
NP_441725.1_5 Reverse -114 -124 11.2881 0.0247
NP_441725.1_5 Forward -121 -111 2.04498 0.115
NP_439966.1_7 Forward -124 -114 18.4657 0.00473
NP_439966.1_7 Reverse -111 -121 7.25606 0.15
NP_439966.1_9 Forward -124 -115 0.983037 0.253
NP_442941.1_3 Reverse -114 -124 11.4848 0.0116
NP_442941.1_3 Forward -121 -111 11.0914 0.0116
NP_440289.1_2 Forward -125 -112 21.3571 0.00262
NP_440983.1_5 Forward -315 -296 -5.99873 0.274
NP_440983.1_5 Forward -119 -100 -8.35868 0.295
NP_440260.1_8 Reverse -104 -122 6.31233 0.154
NP_440260.1_8 Reverse -292 -310 -7.45401 0.295
NP_442281.1_1 Forward -127 -113 19.6651 0.00247
NP_442281.1_1 Reverse -140 -154 5.21053 0.166
NP_442281.1_1 Forward -308 -294 2.26061 0.272
NP_441334.1_7 Reverse -111 -130 -20.4534 0.276
NP_441079.1_7 Forward -92 -73 -7.6711 0.296
NP_440437.1_1 Forward -128 -109 11.5042 0.04
NP_442012.1_1 Reverse -200 -219 2.0644 0.205
NP_442012.1_1 Reverse -107 -126 -0.885524 0.27
NP_441556.1_10 Reverse -108 -122 9.6378 0.294
NP_440375.1_8 Reverse -187 -206 2.65439 0.223
NP_441644.1_6 Forward -122 -112 17.3841 0.00127
NP_441644.1_6 Reverse -113 -123 10.1076 0.0628
NP_441644.1_6 Reverse -294 -304 4.10949 0.249
NP_440867.1_10 Reverse -119 -138 3.44104 0.283
NP_442215.1_2 Reverse -111 -127 17.3648 0.0139
NP_442215.1_2 Forward -124 -108 -4.46469 0.233
NP_442215.1_2 Reverse -136 -152 -5.25134 0.248
NP_442029.1_1 Forward -278 -259 -19.5684 0.291
NP_442029.1_6 Reverse -108 -127 7.7676 0.222
NP_440253.1_2 Reverse -113 -131 -2.24246 0.262
NP_440929.1_8 Forward -122 -113 19.2726 0.000701
NP_440929.1_8 Reverse -113 -122 19.2726 0.000701
NP_442933.1_10 Forward -122 -113 17.601 0.00325
NP_442933.1_10 Reverse -113 -122 17.601 0.00325
NP_441751.2_8 Forward -121 -107 -2.26202 0.132
NP_442926.1_5 Reverse -108 -127 8.81407 0.295
NP_442554.1_8 Forward -121 -111 15.3197 0.00882
NP_442554.1_8 Reverse -114 -124 13.8447 0.0145
NP_442554.1_8 Forward -302 -292 4.40493 0.188
NP_441762.1_7 Forward -123 -111 9.57708 0.0142
NP_441762.1_7 Reverse -112 -124 2.89058 0.0676
NP_442142.1_4 Forward -125 -112 15.85 0.0264
NP_442142.1_4 Reverse -110 -123 5.62358 0.187
NP_442292.1_1 Forward -121 -112 18.486 0.00229
NP_442292.1_1 Reverse -114 -123 9.63616 0.0183
NP_442292.1_5 Reverse -109 -128 0.786102 0.257
NP_442292.1_5 Forward -280 -261 -1.18052 0.257
NP_442476.1_6 Forward -121 -107 11.3077 0.056
NP_440895.1_6 Reverse -11 -24 8.57408 0.258
NP_443009.1_5 Reverse -112 -123 18.3477 0.00265
NP_443009.1_5 Reverse -293 -304 4.97473 0.222
NP_442406.1_9 Reverse -293 -312 6.29264 0.271
NP_442408.2_1 Reverse -113 -132 -6.1954 0.282
NP_441715.1_4 Reverse -114 -124 16.303 0.0117
NP_441715.1_4 Forward -121 -111 7.94484 0.107
NP_440357.1_3 Forward -140 -121 -1.18052 0.297
NP_440183.1_9 Reverse -296 -315 -14.3569 0.264
NP_441198.1_4 Reverse -53 -72 18.1907 0.134
NP_440464.1_10 Forward -121 -111 13.0082 0.169
NP_441468.1_1 Forward -121 -114 15.8704 0.0124
NP_441468.1_1 Reverse -114 -121 15.8704 0.0124
NP_441020.2_6 Reverse -111 -128 13.5102 0.0723
NP_441015.1_10 Reverse -108 -127 -1.47551 0.173
NP_441015.1_10 Forward -278 -259 -3.44213 0.189
NP_441015.1_10 Reverse -114 -133 -11.4069 0.296
NP_441673.1_1 Forward -122 -113 20.8459 0.000698
NP_441673.1_1 Reverse -113 -122 20.8459 0.000698
NP_442253.1_5 Reverse -203 -220 10.5603 0.0922
NP_442253.1_5 Reverse -171 -188 0.432165 0.203
NP_441876.1_9 Forward -133 -123 10.4026 0.293
NP_441826.1_2 Forward -128 -114 13.6676 0.0214
NP_442868.1_6 Reverse -111 -121 9.81313 0.038
NP_442868.1_6 Forward -124 -114 0.963343 0.205
NP_441612.1_2 Forward -122 -112 8.54929 0.21
NP_442227.1_2 Reverse -266 -285 -1.7705 0.266
NP_442361.1_3 Forward -128 -115 19.4888 0.0363
NP_440789.1_1 Forward -53 -34 15.9282 0.191
NP_442808.1_1 Forward -123 -113 18.4657 0.00201
NP_442808.1_1 Reverse -112 -122 8.63269 0.0481
NP_442808.1_1 Forward -130 -120 5.87944 0.137
NP_440145.1_3 Reverse -103 -122 7.47261 0.0466
NP_440145.1_3 Reverse -228 -247 -3.83545 0.212
NP_442542.1_2 Forward -305 -292 7.09911 0.193
NP_442542.1_9 Forward -310 -296 20.6484 0.00986
NP_442542.1_9 Forward -129 -115 20.3534 0.0121
NP_442050.1_5 Forward -124 -114 9.12434 0.193
NP_442050.1_5 Reverse -111 -121 7.64939 0.243
NP_440558.1_2 Reverse -203 -222 5.99764 0.137
NP_440558.1_2 Reverse -104 -123 -0.983855 0.206
NP_440558.1_2 Forward -219 -200 -6.58872 0.277
NP_440558.1_2 Reverse -171 -190 -7.57203 0.296
NP_440162.1_2 Forward -176 -157 7.7676 0.282
NP_441048.1_7 Forward -198 -184 17.3052 0.272
NP_442789.1_4 Reverse -111 -130 -5.70374 0.276
NP_441518.1_3 Forward -132 -113 -7.86702 0.173
NP_441878.1_6 Forward -123 -113 10.4031 0.0176
NP_441878.1_6 Reverse -112 -122 10.4031 0.0176
NP_441878.1_6 Reverse -293 -303 1.16001 0.11
NP_441878.1_6 Forward -304 -294 -7.49312 0.231
NP_441878.1_6 Forward -216 -206 -7.59145 0.245
NP_441036.1_3 Forward -379 -360 8.84924 0.119
NP_441036.1_8 Forward -123 -113 17.7779 0.000554
NP_441036.1_8 Reverse -112 -122 8.33817 0.174
NP_442650.1_2 Forward -122 -108 6.09611 0.134
NP_441557.1_5 Forward -122 -113 19.9609 0.000699
NP_441557.1_5 Reverse -113 -122 19.9609 0.000699
NP_441445.1_1 Reverse -104 -123 8.84924 0.113
NP_441445.1_1 Forward -131 -112 6.19431 0.153
NP_442066.2_4 Reverse -113 -132 -1.18052 0.184
NP_442066.2_4 Reverse -294 -313 -9.24366 0.296
NP_442419.1_2 Forward -121 -102 -5.01543 0.295
NP_440738.1_5 Forward -102 -83 2.45773 0.287
NP_441308.1_8 Forward -124 -114 10.1081 0.22
NP_440101.1_3 Reverse -108 -127 10.9142 0.111
NP_440101.1_5 Forward -129 -110 4.916 0.196
NP_441458.1_10 Forward -131 -112 9.53756 0.157
NP_442183.1_1 Reverse -113 -127 11.996 0.0648
NP_442183.1_1 Forward -278 -264 3.73617 0.299
NP_442397.1_6 Reverse -101 -115 16.0275 0.272
NP_441574.1_1 Reverse -101 -120 -7.57203 0.292
NP_441549.1_9 Reverse -202 -220 0.707465 0.116
NP_441549.1_9 Forward -221 -203 -4.99573 0.198
NP_441549.1_9 Forward -267 -249 -8.92897 0.238
NP_442347.1_2 Forward -121 -112 12.4878 0.056
NP_442347.1_2 Reverse -114 -123 11.1111 0.056
NP_442645.1_2 Reverse -105 -124 7.57094 0.0177
NP_442888.1_6 Forward -376 -357 2.94938 0.244
NP_441037.1_4 Reverse -111 -121 7.9999 0.237
NP_441037.1_4 Forward -124 -114 7.02532 0.237
NP_441037.1_4 Forward -217 -207 6.83041 0.239
NP_442594.1_8 Forward -281 -262 9.0459 0.2
NP_442738.1_7 Forward -275 -256 23.5989 0.0313
NP_441633.1_3 Reverse -111 -124 8.47575 0.0377
NP_441633.1_3 Forward -124 -111 -3.71729 0.177
NP_441633.1_3 Forward -305 -292 -4.89726 0.216
NP_442764.1_8 Forward -205 -186 15.9291 0.0772
NP_440136.1_2 Forward -121 -114 15.9687 0.0123
NP_440136.1_2 Reverse -114 -121 15.9687 0.0123
NP_442590.1_9 Reverse -276 -295 11.6025 0.223
NP_442998.1_5 Reverse -205 -215 8.23984 0.267
NP_442998.1_10 Forward -120 -113 15.5754 0.0102
NP_442998.1_10 Reverse -115 -122 15.5754 0.0102
NP_440299.1_1 Reverse -109 -122 16.2433 0.0109
NP_440299.1_1 Forward -126 -113 11.9167 0.0427
NP_441799.1_1 Reverse -109 -123 21.1401 0.0036
NP_441007.1_10 Reverse -108 -121 1.39592 0.203
NP_442201.1_10 Forward -133 -114 -2.95047 0.146
NP_442333.2_5 Forward -133 -114 -5.9004 0.214
NP_440256.1_1 Reverse -110 -129 17.8957 0.00485
NP_440256.1_1 Forward -125 -106 -2.36049 0.116
NP_440256.1_1 Forward -150 -131 -8.85033 0.268
NP_441229.1_10 Reverse -103 -122 1.67108 0.288
NP_441229.1_10 Forward -225 -206 0.884433 0.288
NP_441559.1_8 Reverse -202 -216 -5.80194 0.27
NP_441559.1_8 Forward -127 -113 -6.29359 0.276
NP_442302.1_6 Reverse -297 -316 18.584 0.227
NP_440915.1_6 Forward -307 -293 13.2743 0.0191
NP_440915.1_6 Forward -126 -112 6.3911 0.0826
NP_442158.1_4 Forward -156 -146 12.3697 0.253
NP_440717.1_1 Reverse -295 -314 10.0292 0.24
NP_442785.1_7 Forward -124 -110 10.7177 0.228
NP_442967.1_10 Reverse -222 -236 15.609 0.237
NP_442866.1_1 Reverse -108 -127 -7.37537 0.266
NP_440748.1_5 Forward -151 -132 -1.37718 0.267
NP_441464.1_8 Forward -122 -108 7.07942 0.219
NP_441464.1_8 Forward -217 -203 4.62115 0.269
NP_440702.1_2 Reverse -111 -130 -0.885524 0.257
NP_440026.1_4 Reverse -110 -129 12.5858 0.239
NP_441494.1_6 Reverse -201 -214 6.1158 0.289
NP_442993.1_1 Reverse -113 -129 -7.21796 0.146
NP_442386.1_9 Forward -123 -114 15.7322 0.0144
NP_442386.1_9 Reverse -112 -121 13.8639 0.0289
NP_442386.1_9 Forward -117 -108 9.5374 0.159
NP_441750.1_1 Reverse -295 -314 -9.93197 0.3
NP_441340.1_5 Forward -121 -114 15.6737 0.0124
NP_441340.1_5 Reverse -114 -121 15.6737 0.0124
NP_439909.1_6 Forward -256 -237 17.2074 0.234
NP_441947.1_4 Forward -133 -114 10.4225 0.299
NP_442791.1_5 Reverse -105 -124 -0.0988766 0.21
NP_442791.1_9 Reverse -259 -278 11.7983 0.284
NP_442714.1_7 Forward -121 -102 1.76941 0.226
NP_440586.1_8 Forward -121 -114 13.2151 0.026
NP_440586.1_8 Reverse -114 -121 13.2151 0.026
NP_442251.1_6 Forward -121 -114 15.2804 0.0124
NP_442251.1_6 Reverse -114 -121 15.2804 0.0124
NP_441262.1_3 Reverse -113 -120 14.7888 0.0223
NP_441262.1_3 Forward -122 -115 14.7888 0.0223
NP_440027.1_3 Forward -132 -114 6.60656 0.225
NP_440027.1_3 Reverse -294 -312 5.1316 0.246
NP_440027.1_3 Forward -122 -104 4.63995 0.255
NP_440027.1_3 Forward -310 -292 3.75497 0.267
NP_443051.1_1 Reverse -112 -121 10.4228 0.00754
NP_443051.1_1 Forward -123 -114 10.4228 0.00754
NP_441232.1_10 Reverse -102 -121 18.1907 0.0267
NP_439937.1_8 Reverse -105 -124 1.96607 0.217
NP_439937.1_9 Reverse -205 -222 -2.02679 0.14
NP_439937.1_9 Forward -123 -106 -6.64833 0.157
NP_439937.1_9 Forward -218 -201 -8.61494 0.176
NP_439937.1_9 Forward -140 -123 -11.5649 0.257
NP_439937.1_9 Reverse -293 -310 -12.7448 0.276
NP_441595.1_2 Reverse -381 -394 9.03802 0.278
NP_441740.2_10 Reverse -107 -126 6.98095 0.286
NP_440439.1_1 Reverse -110 -123 2.57589 0.131
NP_440439.1_1 Forward -125 -112 1.19926 0.159
NP_439943.1_4 Forward -201 -182 10.9142 0.205
NP_439943.1_4 Forward -284 -265 5.60432 0.284
NP_440372.1_2 Forward -121 -114 16.3621 0.0124
NP_440372.1_2 Reverse -114 -121 16.3621 0.0124
NP_441789.1_7 Reverse -259 -278 8.75009 0.193
NP_441789.1_7 Reverse -260 -279 -3.63955 0.277
NP_440819.1_5 Reverse -161 -169 7.68924 0.266
NP_441803.1_2 Forward -127 -108 2.85105 0.203
NP_441803.1_2 Reverse -121 -140 2.26107 0.215
NP_441803.1_2 Reverse -108 -127 -0.000545616 0.263
NP_440139.1_1 Reverse -107 -126 8.06178 0.118
NP_441572.1_7 Forward -128 -109 15.1424 0.026
NP_442384.1_10 Forward -122 -109 18.0139 0.00545
NP_442384.1_10 Reverse -113 -126 8.37742 0.0656
NP_442384.1_10 Forward -26 -13 3.95252 0.172
NP_440364.1_2 Reverse -108 -127 15.2979 0.228
NP_441018.1_7 Reverse -103 -122 10.0292 0.218
NP_441018.1_7 Reverse -109 -128 9.93088 0.218
NP_441018.1_7 Reverse -92 -111 7.17762 0.276
NP_442262.1_10 Forward -121 -114 14.1988 0.0123
NP_442262.1_10 Reverse -114 -121 14.1988 0.0123
NP_442262.1_10 Reverse -295 -302 8.8889 0.219
NP_441689.1_5 Forward -124 -114 8.53436 0.132
NP_441689.1_5 Reverse -111 -121 5.78111 0.197
NP_440163.1_10 Forward -125 -115 15.2213 0.0762
NP_440344.1_10 Forward -129 -112 19.41 0.00206
NP_440344.1_10 Reverse -106 -123 -2.3211 0.0643
NP_440344.1_10 Forward -142 -125 -12.0559 0.239
NP_440531.1_6 Forward -130 -111 14.1591 0.0397
NP_440531.1_6 Reverse -121 -140 5.40766 0.115
NP_440531.1_8 Reverse -80 -99 2.75272 0.283
NP_440487.1_1 Reverse -110 -129 -4.6221 0.214
NP_441965.1_3 Reverse -103 -122 9.53756 0.11
NP_441965.1_10 Forward -125 -109 8.71166 0.123
NP_442556.1_10 Reverse -102 -121 9.30826 0.279
NP_440297.1_9 Reverse -114 -124 9.32148 0.0917
NP_440297.1_9 Forward -121 -111 -0.118297 0.282
NP_441592.1_4 Forward -122 -103 5.99764 0.128
NP_441896.1_1 Forward -53 -34 10.0284 0.234
NP_441896.1_3 Reverse -104 -123 0.786102 0.224
NP_440894.1_10 Forward -140 -121 5.70265 0.228
NP_440894.1_10 Forward -127 -108 3.34271 0.274
NP_440894.1_10 Reverse -289 -308 3.14605 0.278
NP_440999.1_9 Forward -126 -112 14.1593 0.0277
NP_440999.1_9 Forward -307 -293 0.392915 0.187
NP_440888.1_2 Reverse -113 -127 19.8618 0.000937
NP_440888.1_2 Reverse -294 -308 16.2235 0.00758
NP_440888.1_2 Forward -122 -108 10.1271 0.104
NP_440803.1_3 Forward -218 -199 9.14423 0.197
NP_440491.1_1 Reverse -110 -129 12.9594 0.137
NP_440052.1_5 Reverse -102 -121 -0.197208 0.188
NP_441543.1_2 Reverse -114 -123 18.486 0.00236
NP_441543.1_2 Forward -121 -112 16.9127 0.00359
NP_442845.1_2 Reverse -107 -121 16.2242 0.0636
NP_442845.1_2 Forward -122 -108 4.42448 0.259
NP_441469.1_8 Forward -123 -114 16.126 0.00797
NP_441469.1_8 Reverse -112 -121 6.48957 0.227
NP_443064.1_6 Forward -122 -112 12.5669 0.0796
NP_443064.1_6 Forward -26 -16 11.4034 0.13
NP_442578.1_7 Forward -121 -114 14.5921 0.026
NP_442578.1_7 Reverse -114 -121 14.5921 0.026
NP_440710.1_1 Reverse -246 -264 6.80398 0.113
NP_440710.1_1 Forward -130 -112 -1.06249 0.179
NP_440148.1_1 Reverse -163 -182 -5.21209 0.231
NP_441462.1_2 Forward -122 -112 11.5831 0.00406
NP_441462.1_2 Reverse -113 -123 11.5831 0.00406
NP_441462.1_2 Forward -303 -293 -1.10161 0.281
NP_441621.1_7 Reverse -292 -306 -6.58858 0.298
NP_443062.1_1 Reverse -113 -131 10.106 0.121
NP_443062.1_6 Reverse -105 -124 0.491109 0.294
NP_442204.1_1 Forward -126 -115 0.353664 0.281
NP_442204.1_1 Reverse -13 -24 0.255333 0.282
NP_442204.1_5 Forward -132 -113 13.0775 0.0599
NP_442204.1_5 Forward -225 -206 -0.39387 0.286
NP_441560.1_8 Reverse -289 -308 14.6291 0.139
NP_441351.1_8 Reverse -301 -320 7.7676 0.192
NP_440516.1_8 Forward -122 -113 16.9127 0.00442
NP_440516.1_8 Reverse -113 -122 16.9127 0.00442
NP_442428.1_5 Forward -121 -114 15.8704 0.0124
NP_442428.1_5 Reverse -114 -121 15.8704 0.0124
NP_440673.1_2 Reverse -103 -122 18.5839 0.0423
NP_440673.1_2 Forward -132 -113 15.3647 0.0888
NP_440673.1_3 Forward -120 -113 12.4288 0.0426
NP_440673.1_3 Reverse -115 -122 12.4288 0.0426
NP_440673.1_3 Reverse -296 -303 8.98723 0.203
NP_440673.1_7 Forward -133 -114 11.9958 0.103
NP_441052.1_2 Forward -122 -112 19.9412 0.00106
NP_441052.1_2 Reverse -113 -123 10.5014 0.0285
NP_442219.1_8 Reverse -103 -122 12.9021 0.153
NP_442219.1_9 Forward -121 -112 17.7976 0.00718
NP_442219.1_9 Reverse -114 -123 8.35786 0.0681
NP_440436.1_4 Reverse -114 -123 18.1905 0.00233
NP_440436.1_4 Forward -121 -112 17.2072 0.00233
NP_441884.1_9 Forward -125 -106 -12.4886 0.138
NP_441884.1_9 Reverse -110 -129 -22.42 0.278
NP_441884.1_9 Reverse -291 -310 -24.0916 0.284
NP_442086.1_3 Forward -121 -102 14.3558 0.11
NP_442864.1_4 Reverse -91 -109 16.9321 0.166
NP_442907.1_9 Forward -127 -108 -1.7705 0.24
NP_441719.1_4 Forward -121 -114 16.3621 0.0124
NP_441719.1_4 Reverse -114 -121 16.3621 0.0124
NP_441004.1_1 Reverse -188 -207 -11.8003 0.242
NP_441004.1_4 Forward -306 -296 7.74818 0.289
NP_442813.1_4 Forward -233 -214 3.53937 0.197
NP_442813.1_4 Reverse -111 -130 0.392778 0.2
NP_442366.1_3 Reverse -112 -130 -1.94747 0.219
NP_442366.1_5 Reverse -110 -120 17.2858 0.0141
NP_440129.1_10 Forward -129 -115 3.93283 0.187
NP_442854.1_6 Reverse -97 -116 7.27595 0.229
NP_443054.1_2 Reverse -292 -306 3.93283 0.24
NP_443054.1_2 Reverse -111 -125 3.24451 0.24
NP_443054.1_2 Forward -124 -110 1.76955 0.245
NP_440864.1_5 Forward -289 -270 21.7306 0.105
NP_441851.1_10 Forward -123 -113 16.008 0.00552
NP_441851.1_10 Reverse -112 -122 15.8113 0.00552
NP_442622.1_5 Forward -124 -105 -4.32711 0.197
NP_442856.1_7 Forward -131 -112 5.01433 0.131
NP_442515.1_1 Forward -304 -290 -4.81863 0.298
NP_442515.1_1 Reverse -112 -126 -4.91696 0.298
NP_441396.1_5 Forward -268 -259 8.25953 0.224
NP_441396.1_5 Reverse -198 -207 7.66954 0.241
NP_440593.1_3 Forward -127 -108 -0.197208 0.199
NP_442709.1_2 Reverse -263 -282 6.29183 0.12
NP_440940.1_7 Forward -132 -114 10.7364 0.128
NP_441349.1_10 Reverse -103 -122 2.65439 0.0738
NP_441349.1_10 Forward -132 -113 -6.68705 0.235
NP_440432.1_9 Reverse -114 -129 -0.511758 0.164
NP_442843.1_1 Reverse -278 -297 -2.75381 0.212
NP_442843.1_1 Forward -285 -266 -7.08038 0.245
NP_439960.1_3 Forward -303 -284 0.884433 0.263
NP_440474.1_8 Reverse -114 -128 7.17714 0.207
NP_440431.1_3 Reverse -327 -346 -4.32711 0.178
NP_442450.1_5 Forward -124 -114 9.32148 0.115
NP_442450.1_5 Reverse -111 -121 7.55152 0.13
NP_442168.1_5 Forward -121 -102 0.196116 0.257
NP_440588.1_2 Reverse -104 -123 6.78429 0.0535
NP_439950.1_1 Reverse -80 -89 14.4544 0.224
NP_440943.1_1 Forward -271 -252 12.9791 0.23
NP_442006.1_2 Forward -312 -295 -6.94266 0.169
NP_440483.1_1 Forward -308 -289 -3.73712 0.218
NP_441570.1_1 Reverse -113 -131 17.6204 0.00337
NP_441570.1_1 Forward -122 -104 -6.4707 0.0796
NP_441078.1_4 Forward -122 -113 19.6659 0.0007
NP_441078.1_4 Reverse -113 -122 19.6659 0.0007
NP_441078.1_4 Forward -215 -206 3.53964 0.136
NP_441078.1_4 Forward -303 -294 -1.57357 0.266
NP_442729.1_8 Forward -126 -113 8.18076 0.125
NP_442443.1_1 Forward -223 -204 13.5691 0.0815
NP_440526.1_3 Reverse -114 -125 1.92649 0.267
NP_440526.1_3 Forward -121 -110 0.943182 0.267
NP_441432.1_8 Reverse -112 -121 16.8143 0.00595
NP_441432.1_8 Forward -123 -114 8.25953 0.0755
NP_441432.1_8 Forward -304 -295 3.7363 0.243
NP_441432.1_9 Forward -178 -165 13.931 0.157
NP_442320.1_8 Forward -128 -114 13.4709 0.0144
NP_442320.1_8 Reverse -107 -121 -1.47537 0.082
NP_441732.1_2 Forward -126 -110 3.00846 0.0141
NP_441732.1_2 Reverse -109 -125 -17.346 0.253
NP_440313.1_5 Reverse -268 -286 12.4081 0.235
NP_442003.1_9 Reverse -114 -133 2.45773 0.298
NP_440760.1_1 Forward -122 -103 -13.6686 0.11
NP_442797.1_7 Forward -123 -105 4.05072 0.234
NP_442797.1_7 Reverse -106 -124 -1.45582 0.299
NP_440199.1_10 Forward -125 -115 14.533 0.0861
NP_440578.1_10 Reverse -83 -102 8.65258 0.286
NP_442353.1_4 Forward -128 -109 12.6833 0.0776
NP_442353.1_4 Reverse -117 -136 8.25844 0.156
NP_442510.1_9 Forward -307 -293 15.9292 0.279
NP_440913.1_1 Reverse -111 -129 4.14905 0.279
NP_441023.1_6 Forward -305 -286 22.1239 0.0325
NP_441072.1_2 Reverse -109 -128 6.58763 0.275
NP_442010.1_1 Reverse -368 -386 13.588 0.205
NP_442489.1_7 Forward -122 -113 20.1576 0.000695
NP_442489.1_7 Reverse -113 -122 20.1576 0.000695
NP_442489.1_7 Forward -303 -294 -1.57357 0.213
NP_442489.1_7 Reverse -294 -303 -1.86856 0.259
NP_440559.1_1 Forward -121 -112 17.4043 0.00658
NP_440559.1_1 Reverse -114 -123 8.75118 0.0586
NP_441659.2_8 Forward -122 -112 18.1713 0.00133
NP_441659.2_8 Reverse -113 -123 11.9764 0.0147
NP_441040.1_2 Reverse -111 -130 -5.80207 0.181
NP_441040.1_2 Forward -311 -292 -12.9802 0.267
NP_442849.1_1 Reverse -158 -172 11.7993 0.203
NP_440335.1_9 Reverse -138 -156 12.3105 0.263
NP_440779.1_5 Reverse -113 -130 -15.0058 0.3
NP_442346.1_5 Reverse -112 -122 16.6963 0.00248
NP_442346.1_5 Forward -123 -113 9.02648 0.118
NP_440352.1_5 Forward -24 -5 13.4344 0.189
NP_440545.1_3 Reverse -109 -126 12.0352 0.0222
NP_440545.1_3 Forward -219 -202 -3.79607 0.212
NP_440545.1_3 Reverse -202 -219 -3.79607 0.212
NP_440545.1_5 Reverse -109 -126 10.5603 0.21
NP_440025.1_1 Reverse -109 -128 11.3075 0.157
NP_440831.1_3 Forward -312 -293 8.03745 0.233
NP_440831.1_3 Forward -131 -112 4.63975 0.298
NP_440459.1_2 Forward -131 -114 10.1669 0.207
NP_440459.1_2 Reverse -104 -121 7.80699 0.278
NP_440010.1_3 Forward -315 -296 1.17943 0.25
NP_440010.1_10 Reverse -289 -308 3.53937 0.254
NP_441943.1_5 Forward -269 -250 17.4231 0.189
NP_442551.1_4 Reverse -204 -219 -0.80675 0.245
NP_440847.1_3 Forward -293 -279 13.6669 0.209
NP_442603.1_9 Forward -113 -95 -0.0791831 0.3
NP_442603.1_9 Reverse -262 -280 -0.472507 0.3
NP_441585.1_2 Reverse -283 -302 14.0608 0.277
NP_441888.1_7 Forward -127 -113 2.5562 0.225
NP_441948.1_4 Forward -129 -111 -2.93078 0.179
NP_441948.1_4 Reverse -106 -124 -6.07737 0.287
NP_441833.1_4 Forward -121 -114 15.9687 0.0124
NP_441833.1_4 Reverse -114 -121 15.9687 0.0124
NP_441895.1_10 Reverse -157 -176 -27.4349 0.282
NP_441112.1_6 Forward -132 -113 -0.885524 0.295
NP_441112.1_6 Forward -101 -82 -4.32711 0.296
NP_442162.1_9 Forward -121 -114 16.2637 0.0124
NP_442162.1_9 Reverse -114 -121 16.2637 0.0124
NP_440671.1_1 Reverse -34 -53 9.385 0.203
NP_440671.1_4 Forward -128 -114 10.226 0.163
NP_440224.1_1 Reverse -102 -121 1.76941 0.132
NP_441044.1_4 Reverse -265 -283 5.52568 0.227
NP_442140.1_3 Forward -121 -111 12.2714 0.0632
NP_442140.1_3 Reverse -114 -124 8.33817 0.119
NP_440875.1_9 Reverse -115 -125 8.37203 0.233
NP_441813.1_3 Forward -351 -332 13.4617 0.284
NP_441813.1_5 Forward -124 -114 17.188 0.00979
NP_441813.1_5 Reverse -111 -121 8.63316 0.0367
NP_440590.1_4 Reverse -114 -127 13.0973 0.013
NP_440590.1_4 Forward -121 -108 9.65572 0.0341
NP_440590.1_4 Forward -25 -12 1.78924 0.111
NP_440567.1_1 Forward -121 -107 20.0591 0.0136
NP_440567.1_1 Reverse -114 -128 14.0609 0.0191
NP_442497.1_10 Forward -121 -112 10.4228 0.0087
NP_442497.1_10 Reverse -114 -123 10.4228 0.0087
NP_440821.1_4 Forward -124 -114 19.0562 0.00399
NP_440821.1_4 Reverse -111 -121 9.41981 0.0286
NP_441239.1_9 Forward -124 -112 13.3137 0.037
NP_441239.1_9 Forward -305 -293 7.51213 0.158
NP_441239.1_9 Reverse -292 -304 7.31547 0.165
NP_441239.1_9 Reverse -111 -123 5.93884 0.202
NP_441951.1_4 Reverse -295 -314 4.916 0.273
NP_441951.1_9 Forward -311 -292 2.65439 0.254
NP_441892.1_1 Forward -131 -114 12.7235 0.0475
NP_441892.1_1 Reverse -120 -137 -5.66436 0.285
NP_442270.1_6 Forward -20 -2 15.1621 0.279
NP_441017.1_6 Forward -126 -112 16.4202 0.0651
NP_441874.1_1 Forward -389 -375 17.7975 0.165
NP_441541.1_1 Forward -399 -381 -4.58163 0.279
NP_440833.1_6 Forward -108 -94 11.2087 0.225
NP_440833.1_6 Forward -295 -281 10.8154 0.242
NP_442138.1_10 Reverse -113 -132 8.35759 0.0577
NP_440546.1_4 Reverse -113 -123 11.8882 0.0679
NP_440546.1_4 Forward -122 -112 10.046 0.109
NP_441230.1_5 Forward -127 -108 -0.295539 0.281
NP_440675.1_1 Reverse -110 -129 2.75272 0.262
NP_440462.1_6 Forward -124 -114 15.418 0.0142
NP_440462.1_6 Reverse -111 -121 1.35667 0.294
NP_442340.1_3 Reverse -296 -315 -6.1954 0.223
NP_440868.1_4 Reverse -109 -121 15.7719 0.0164
NP_440868.1_4 Forward -126 -114 1.7106 0.174
NP_441474.1_1 Reverse -259 -278 4.12856 0.221
NP_442402.1_4 Forward -166 -147 -7.86776 0.278
NP_442402.1_10 Reverse -371 -381 15.6142 0.175
NP_441848.1_7 Reverse -3 -22 -1.37794 0.247
NP_441084.1_6 Reverse -354 -368 10.7985 0.228
NP_439942.1_7 Reverse -83 -102 5.30933 0.149
NP_440696.1_3 Reverse -109 -127 3.65739 0.206
NP_440696.1_3 Forward -132 -114 -2.3408 0.274
NP_440696.1_3 Reverse -291 -309 -2.63579 0.278
NP_440696.1_3 Reverse -103 -121 -3.81576 0.29
NP_442039.1_4 Forward -121 -114 15.1821 0.0124
NP_442039.1_4 Reverse -114 -121 15.1821 0.0124
NP_442039.1_7 Reverse -122 -132 12.2714 0.249
NP_442039.1_7 Reverse -303 -313 11.1898 0.257
NP_441811.1_8 Reverse -107 -121 7.27608 0.251
NP_442891.1_6 Forward -258 -239 18.3655 0.297
NP_442679.1_1 Reverse -157 -176 7.37428 0.147
NP_442679.1_1 Reverse -67 -86 5.40766 0.147
NP_440825.1_7 Forward -121 -111 12.9096 0.152
NP_442837.1_3 Forward -121 -114 15.7721 0.0124
NP_442837.1_3 Reverse -114 -121 15.7721 0.0124
NP_442053.1_1 Forward -122 -113 18.3876 0.0007
NP_442053.1_1 Reverse -113 -122 18.3876 0.0007
NP_440505.1_3 Forward -124 -114 13.8447 0.0247
NP_440505.1_3 Reverse -111 -121 9.22315 0.122
NP_440505.1_3 Reverse -305 -315 5.28991 0.236
NP_441701.1_3 Reverse -98 -115 8.69197 0.247
NP_441203.1_1 Reverse -114 -133 -12.0953 0.143
NP_440914.1_1 Forward -122 -112 17.5935 0.000537
NP_440914.1_1 Forward -26 -16 8.71269 0.186
NP_440914.1_1 Reverse -113 -123 8.6151 0.186
NP_441011.1_8 Reverse -114 -123 16.9127 0.00602
NP_441011.1_8 Forward -121 -112 8.25953 0.144
NP_442533.1_1 Reverse -110 -129 -5.99873 0.158
NP_442533.1_6 Forward -122 -113 17.2076 0.00137
NP_442533.1_6 Reverse -113 -122 17.2076 0.00137
NP_442533.1_6 Reverse -294 -303 5.3096 0.145
NP_442533.1_6 Reverse -129 -138 4.52295 0.179
NP_442541.1_10 Reverse -293 -307 7.76712 0.225
NP_442232.1_3 Forward -281 -262 -14.9469 0.288
NP_442232.1_3 Forward -34 -15 -15.1435 0.289
NP_442322.1_4 Reverse -261 -278 -9.99156 0.297
NP_442229.1_1 Reverse -111 -125 8.25877 0.184
NP_441482.1_7 Forward -128 -114 -8.75187 0.193
NP_439944.1_9 Forward -121 -111 10.5014 0.0887
NP_439944.1_9 Reverse -114 -124 10.3048 0.0887
NP_441697.1_5 Reverse -73 -92 -8.54695 0.263
NP_441028.1_6 Reverse -372 -382 17.1874 0.132
NP_441527.1_4 Reverse -152 -171 -2.53096 0.158
NP_441527.1_4 Reverse -70 -89 -4.4408 0.186
NP_441527.1_4 Reverse -153 -172 -8.92892 0.253
NP_441527.1_4 Reverse -139 -158 -12.2711 0.285
NP_440115.1_6 Reverse -110 -120 8.33817 0.13
NP_440007.1_9 Forward -126 -112 4.03116 0.267
NP_439965.1_1 Reverse -104 -123 -2.95047 0.179
NP_440608.1_6 Forward -121 -102 6.29183 0.238
NP_443045.1_9 Reverse -268 -286 6.90155 0.284
NP_441602.1_3 Reverse -108 -127 0.884433 0.217
NP_441602.1_3 Reverse -201 -220 -3.04881 0.241
NP_441602.1_3 Reverse -289 -308 -4.13045 0.261
NP_441170.1_4 Reverse -104 -122 2.67408 0.283
NP_441972.1_5 Reverse -114 -133 -3.54046 0.2
NP_441106.1_1 Forward -123 -114 18.191 0.0028
NP_441106.1_1 Reverse -112 -121 9.63616 0.0311
NP_440429.1_2 Forward -121 -102 10.1275 0.267
NP_442306.1_10 Forward -142 -123 -21.4367 0.27
NP_441286.1_1 Reverse -112 -124 14.4936 0.00418
NP_441286.1_1 Forward -123 -111 3.38223 0.0467
NP_442674.1_3 Forward -130 -111 9.93006 0.174
NP_440670.1_8 Forward -122 -113 18.3876 0.000699
NP_440670.1_8 Reverse -113 -122 18.3876 0.000699
NP_441930.1_2 Forward -304 -294 13.5497 0.24
NP_441930.1_2 Forward -216 -206 12.3697 0.262
NP_440886.1_7 Forward -123 -113 17.7774 0.0011
NP_440886.1_7 Reverse -112 -122 7.94438 0.0805
NP_440886.1_7 Reverse -259 -269 6.27276 0.134
NP_442614.1_2 Forward -122 -108 12.4876 0.157
NP_442072.1_9 Reverse -112 -130 -13.3539 0.11
NP_442072.1_9 Reverse -293 -311 -22.597 0.246
NP_442072.1_9 Forward -380 -362 -23.3836 0.292
NP_442401.1_2 Forward -123 -104 19.8614 0.0594
NP_439899.1_1 Reverse -33 -51 8.76215 0.18
NP_441753.1_3 Reverse -200 -219 16.2241 0.142
NP_441808.1_8 Reverse -335 -354 5.70265 0.298
NP_440907.2_8 Reverse -114 -124 7.84605 0.117
NP_440907.2_8 Forward -121 -111 7.64939 0.117
NP_439967.1_7 Forward -123 -105 10.7372 0.213
NP_441021.1_8 Reverse -108 -126 4.34571 0.223
NP_441463.1_3 Forward -132 -113 -10.4236 0.294
NP_441626.1_2 Forward -121 -114 15.7721 0.0124
NP_441626.1_2 Reverse -114 -121 15.7721 0.0124
NP_441626.1_6 Forward -126 -108 7.29487 0.263
NP_441460.1_5 Forward -321 -307 15.0436 0.251
NP_442794.1_1 Reverse -13 -25 5.93884 0.198
NP_442794.1_1 Reverse -109 -121 2.69391 0.286
NP_442615.1_1 Reverse -104 -122 -0.669169 0.12
NP_441962.1_4 Reverse -108 -127 -1.67217 0.125
NP_441962.1_4 Forward -121 -102 -5.9004 0.175
NP_440387.1_1 Forward -122 -106 5.36841 0.0325
NP_440387.1_1 Forward -263 -247 2.22182 0.085
NP_440387.1_1 Reverse -113 -129 -1.41643 0.142
NP_441431.1_2 Forward -132 -118 11.4053 0.138
NP_441431.1_2 Forward -125 -111 9.24208 0.19
NP_441993.1_1 Reverse -113 -132 3.60346 0.231
NP_440358.1_8 Reverse -91 -110 4.42435 0.212
NP_440114.1_10 Forward -122 -108 8.55439 0.2
NP_440114.1_10 Forward -303 -289 7.86607 0.223
NP_440114.1_10 Reverse -113 -127 7.57108 0.231
NP_441858.1_3 Forward -347 -328 17.0099 0.232
NP_441510.2_7 Forward -128 -114 11.7987 0.28
NP_441552.1_3 Reverse -106 -125 17.5998 0.123
NP_440766.1_4 Forward -126 -112 8.55439 0.0871
NP_440766.1_5 Forward -264 -252 7.27382 0.29
NP_441237.1_9 Forward -121 -111 14.828 0.0242
NP_442743.1_4 Reverse -114 -133 -6.88371 0.279
NP_442743.1_5 Reverse -108 -127 8.84924 0.148
NP_439910.1_2 Forward -130 -113 -21.4956 0.183
NP_440502.1_3 Forward -314 -304 15.1535 0.2
NP_442867.1_8 Reverse -269 -288 4.32602 0.284
NP_440457.1_1 Forward -126 -114 7.02048 0.105
NP_440457.1_1 Reverse -109 -121 2.69391 0.205
NP_442940.1_2 Forward -215 -196 10.9142 0.167
NP_440798.1_6 Forward -121 -108 5.52582 0.14
NP_442680.1_5 Reverse -158 -177 3.49139 0.23
NP_442680.1_5 Reverse -159 -178 2.31911 0.237
NP_441984.1_3 Reverse -290 -308 8.27895 0.232
NP_441984.1_3 Reverse -134 -152 6.50899 0.269
NP_441332.1_6 Forward -130 -120 12.034 0.236
NP_441436.1_6 Reverse -113 -132 12.5858 0.193
NP_441436.1_6 Reverse -294 -313 8.45592 0.26
NP_441436.1_8 Forward -278 -259 16.1257 0.215
NP_440473.1_9 Forward -133 -114 -8.55534 0.252
NP_442509.1_8 Forward -121 -105 18.4457 0.148
NP_442509.1_9 Reverse -113 -123 16.2041 0.00739
NP_442509.1_9 Forward -122 -112 8.14104 0.192
NP_442514.1_5 Forward -318 -299 0.686995 0.178
NP_440734.1_9 Forward -132 -113 16.8141 0.132
NP_440554.1_4 Reverse -114 -124 14.6313 0.02
NP_442737.1_5 Reverse -112 -131 12.6851 0.261
NP_441885.1_5 Forward -122 -112 20.9245 0.000538
NP_441885.1_5 Reverse -113 -123 11.4848 0.00668
NP_442341.1_7 Reverse -112 -126 19.7641 0.00702
NP_442341.1_7 Reverse -293 -307 9.73436 0.0722
NP_442341.1_7 Reverse -205 -219 8.94771 0.0801
NP_442341.1_7 Forward -123 -109 7.9644 0.0956
NP_442341.1_9 Forward -124 -110 13.1753 0.0878
NP_441173.1_9 Reverse -373 -381 11.3271 0.226
NP_440191.1_4 Reverse -373 -383 13.439 0.282
NP_440750.1_5 Reverse -155 -169 5.80112 0.238
NP_443000.1_7 Reverse -111 -121 10.3048 0.0345
NP_443000.1_7 Forward -124 -114 8.73149 0.0437
NP_442513.1_5 Forward -130 -111 6.68515 0.282
NP_441842.1_1 Forward -120 -107 16.4399 0.0484
NP_441842.1_10 Forward -129 -115 16.3225 0.0311
NP_441842.1_10 Reverse -106 -120 12.7826 0.0918
NP_441842.1_10 Forward -310 -296 7.17775 0.264
NP_440275.1_3 Forward -124 -114 8.4365 0.0602
NP_440275.1_3 Reverse -111 -121 8.04317 0.0602
NP_440091.1_1 Forward -126 -114 10.7571 0.0429
NP_440091.1_1 Reverse -109 -121 8.29878 0.0653
NP_440091.1_1 Forward -30 -18 0.333971 0.254
NP_440312.1_8 Forward -399 -380 14.0542 0.271
NP_443060.1_5 Reverse -105 -124 20.2548 0.0357
NP_441397.1_8 Forward -17 -4 13.4306 0.245
NP_443010.1_10 Forward -125 -108 4.8001 0.219
NP_442451.1_2 Forward -311 -292 -2.16383 0.179
NP_442451.1_2 Forward -130 -111 -10.1286 0.265
NP_439962.1_4 Forward -311 -292 -0.885524 0.204
NP_439962.1_8 Forward -382 -363 6.19431 0.287
NP_442495.1_4 Reverse -89 -99 11.5831 0.271
NP_440149.1_8 Reverse -113 -132 5.89931 0.0726
NP_440149.1_8 Forward -122 -103 -6.68705 0.258
NP_441105.1_3 Forward -158 -139 -6.09707 0.229
NP_440216.1_1 Reverse -113 -127 8.25939 0.0061
NP_440216.1_1 Forward -122 -108 -0.197071 0.0284
NP_440216.1_6 Forward -129 -113 5.17175 0.189
NP_440216.1_9 Reverse -146 -155 12.3894 0.241
NP_440216.1_9 Reverse -225 -234 6.19458 0.289
NP_440216.1_9 Reverse -147 -156 6.19458 0.289
NP_440172.1_1 Forward -122 -112 15.0247 0.00945
NP_440172.1_1 Reverse -113 -123 8.73149 0.0586
NP_440167.1_3 Reverse -103 -122 9.43923 0.256
NP_442015.1_10 Forward -126 -113 10.639 0.0391
NP_442015.1_10 Reverse -109 -122 10.5407 0.0391
NP_442015.1_10 Reverse -13 -26 3.36254 0.183
NP_441226.1_7 Forward -121 -114 14.4934 0.0123
NP_441226.1_7 Reverse -114 -121 14.4934 0.0123
NP_441226.1_7 Forward -115 -108 8.29857 0.205
NP_441226.1_7 Forward -128 -121 6.52862 0.253
NP_441111.1_7 Forward -121 -113 18.7023 0.00294
NP_441111.1_7 Reverse -114 -122 18.7023 0.00294
NP_441766.1_2 Forward -122 -113 17.5026 0.00297
NP_441766.1_2 Reverse -113 -122 17.5026 0.00297
NP_442417.1_5 Reverse -113 -127 11.5043 0.0983
NP_440416.1_9 Forward -129 -110 -4.72043 0.0783
NP_440416.1_9 Reverse -106 -125 -19.1751 0.27
NP_443052.1_8 Forward -132 -113 6.58763 0.0298
NP_443052.1_9 Reverse -266 -285 -5.11376 0.265
NP_441135.1_4 Reverse -116 -135 3.6377 0.284
NP_442154.1_1 Reverse -105 -123 -13.4522 0.217
NP_442154.1_1 Reverse -96 -114 -19.3521 0.298
NP_442154.1_6 Reverse -106 -125 2.26107 0.234
NP_440261.1_5 Forward -302 -289 -4.7006 0.165
NP_440261.1_5 Forward -137 -124 -6.56889 0.201
NP_440261.1_5 Reverse -114 -127 -10.5021 0.201
NP_440261.1_5 Forward -121 -108 -12.0754 0.27
NP_440988.1_4 Reverse -276 -295 14.2574 0.185
NP_440988.1_10 Forward -124 -110 8.09365 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAATTTAATTGTTTTGAAATGGGGGAAAGTCTATTGTTAATGGCTTCTAGCGACAACTATGTGGGCAACAGTCTGTGCTTAGTTAACTGTCCCCAGCGGCAATGGGCCCAAATTACCCATTGGGGGAGTCGGTTGGTGGCGGAAACCTTACTGTGGGATAGATTAGTTTTCCATTGTCTAGCGGGGGATATGCCCCCCACCGTTTGGTCAATGAATTGGCAATTCTCCCCCTTTTTTCCGCCCTTTTTCCATTGGCGCTTTCAGGCTTGGCCCCCAACGGCGATCGCCAACCCAGCAACTTGCCCAGCAAATAATTCCTCCGTTCTTTTATTCTGAAACCTAGCCCCTCTTTACAATCGTTTACAATAGGGAGGAACGATCAGCAGGGAAGAAATTGGTT

CDS

ATGGAACTCACCTGGTACGACAGCAACTCTTGGCTAATTGAGATGGGCGGACAGAGAATTTTGCTTGATCCTTGGTTGGTGGGGGACCTAACCTTTGGCAATACGCCCTGGTTATTTCGGGGTTTTCGCTCCCAGCCCTTGGCAATTCCGGAAAACATTGACCTAATTTTGCTTTCCCAGGGTTTGGAAGACCATGCCCATCCCCCCACATTGAAAGAATTGGACAAAAGTTGGCCTGTTCTTGGTTCCCCCAAAGCCGCTGAAGTTGCCACCGAGTTGGGCTATGAAACAGTAACAGGTCTACCCCATAACCAAAAATTTGTGCTTAACGACCGGGTGGAAATCCTTGCTCTACCCGGTTCCCCCATTGGCCCCACCCTGGTGGAAAATGCCTATGTGTTAACGGATCTACAAACCAGCACCAAACTCTATTACGAACCCCACGGTTTCCACTCTCCCCAACTGCAAGACTTGGGGCCCATTGATGTGGTTTTAACCCCCGTCATTGGCATCAATATCCTCGGATTCCTGCCGGTGCTCAATGGCCAGAAAACCACCCTGGAGCTTTGTCGCACTGTCCATCCCCAGGCGATCGTCCCCACCTCTGGAGCCGCAGAATTGAACTATAGCGGTTTACTAACTAAAGTTTTACGTTTAGACGGCGATCTCAGTCAATTTCGCCAGTCCCTAATTGACGAAGGGATACAAGCTTCCCTATGGGAACCCCAGGTGGGAGTGCCCCTCAATGTGCCCCAATCCACCGTTGGCTAG

Protein

MELTWYDSNSWLIEMGGQRILLDPWLVGDLTFGNTPWLFRGFRSQPLAIPENIDLILLSQGLEDHAHPPTLKELDKSWPVLGSPKAAEVATELGYETVTGLPHNQKFVLNDRVEILALPGSPIGPTLVENAYVLTDLQTSTKLYYEPHGFHSPQLQDLGPIDVVLTPVIGINILGFLPVLNGQKTTLELCRTVHPQAIVPTSGAAELNYSGLLTKVLRLDGDLSQFRQSLIDEGIQASLWEPQVGVPLNVPQSTVG