Your browser is old and dusty. Try Google Chrome!

Details for sll0154

ORF sll0154
Accession NP_442008.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -302 -283 -11.8003 0.0565
NP_442291.1_5 Forward -291 -275 17.9548 0.0165
NP_442291.1_7 Forward -300 -286 17.3058 0.211
NP_440897.1_6 Reverse -257 -276 3.63691 0.143
NP_441453.1_4 Reverse -281 -289 7.19758 0.0757
NP_441453.1_4 Forward -290 -282 6.80426 0.121
NP_441453.1_4 Reverse -78 -86 5.32929 0.147
NP_442151.1_6 Reverse -231 -245 9.2427 0.155
NP_440226.1_1 Forward -290 -271 19.5673 0.0109
NP_440226.1_1 Reverse -198 -217 5.99764 0.139
NP_442169.1_1 Forward -266 -247 -0.0988766 0.261
NP_440931.1_7 Forward -318 -300 12.703 0.258
NP_440150.1_2 Forward -251 -232 3.73524 0.293
NP_442655.1_1 Forward -307 -288 0.58944 0.24
NP_442173.1_1 Forward -86 -78 11.3275 0.0463
NP_442173.1_1 Forward -289 -281 7.68924 0.142
NP_442173.1_1 Reverse -282 -290 5.72262 0.203
NP_442752.1_4 Forward -290 -283 13.8055 0.0199
NP_443027.1_4 Forward -292 -282 7.25653 0.24
NP_440784.1_7 Forward -289 -282 6.23397 0.241
NP_440784.1_7 Reverse -282 -289 6.13563 0.241
NP_440061.1_9 Reverse -279 -293 16.1252 0.0311
NP_440061.1_9 Reverse -76 -90 8.06211 0.183
NP_441054.1_1 Forward -297 -283 14.1593 0.231
NP_442062.1_8 Forward -290 -280 14.6313 0.012
NP_442062.1_8 Reverse -281 -291 5.09324 0.184
NP_440761.1_4 Reverse -20 -39 -20.65 0.289
NP_441900.1_2 Forward -378 -360 7.58986 0.121
NP_441859.1_3 Reverse -77 -96 2.35861 0.262
NP_441802.1_1 Reverse -4 -23 8.16093 0.224
NP_440304.1_4 Reverse -29 -39 5.28991 0.218
NP_442242.1_4 Reverse -282 -289 10.8555 0.127
NP_441200.1_4 Reverse -2 -21 11.2092 0.173
NP_442110.1_7 Reverse -281 -295 1.96621 0.222
NP_442726.1_1 Forward -295 -276 7.86593 0.288
NP_441083.1_5 Reverse -281 -291 1.74999 0.198
NP_441083.1_5 Forward -290 -280 0.963343 0.218
NP_442827.1_8 Forward -95 -76 -2.55791 0.282
NP_441738.1_2 Reverse -283 -290 15.28 0.0102
NP_441738.1_2 Reverse -373 -380 11.8385 0.0469
NP_441738.1_2 Reverse -80 -87 10.0685 0.125
NP_441738.1_2 Forward -358 -351 8.29857 0.176
NP_441558.1_5 Reverse -279 -298 13.7658 0.0561
NP_441558.1_5 Reverse -76 -95 6.88262 0.2
NP_440209.1_1 Forward -290 -282 8.57422 0.0425
NP_440209.1_1 Reverse -281 -289 5.32929 0.139
NP_441713.1_1 Forward -93 -74 -16.8151 0.286
NP_442570.1_3 Reverse -223 -242 -2.85214 0.215
NP_442570.1_3 Reverse -327 -346 -8.06369 0.279
NP_442462.1_9 Reverse -301 -320 14.5524 0.292
NP_441716.1_1 Forward -296 -282 8.65272 0.137
NP_442111.1_4 Reverse -280 -294 3.8345 0.229
NP_440906.1_5 Forward -289 -282 6.23397 0.234
NP_440906.1_5 Reverse -282 -289 6.13563 0.241
NP_440747.1_10 Forward -293 -281 7.02048 0.0108
NP_440747.1_10 Reverse -278 -290 -2.71429 0.0639
NP_441486.1_1 Reverse -278 -292 -5.21195 0.226
NP_441486.1_1 Forward -243 -229 -5.60527 0.248
NP_442330.1_4 Reverse -5 -24 14.9461 0.263
NP_442634.1_4 Reverse -328 -342 -4.91696 0.223
NP_440403.1_5 Forward -368 -349 11.8975 0.216
NP_440403.1_10 Forward -266 -247 2.55606 0.279
NP_442848.1_1 Forward -296 -282 -1.8687 0.263
NP_442848.1_1 Forward -93 -79 -4.03198 0.279
NP_442848.1_1 Reverse -275 -289 -4.22864 0.282
NP_441012.1_4 Reverse -283 -296 6.1158 0.286
NP_443018.1_3 Forward -289 -282 12.6255 0.0471
NP_443018.1_3 Forward -239 -232 10.4622 0.103
NP_443018.1_3 Forward -39 -32 7.6106 0.156
NP_443018.1_3 Reverse -282 -289 5.25066 0.214
NP_443018.1_3 Reverse -232 -239 4.36568 0.254
NP_440376.1_1 Forward -290 -281 -0.000272808 0.285
NP_440376.1_1 Reverse -281 -290 -0.0986038 0.285
NP_442730.1_8 Forward -42 -23 8.84842 0.185
NP_442191.1_4 Reverse -342 -356 15.4531 0.0603
NP_442485.1_3 Reverse -282 -301 -5.01543 0.287
NP_442485.1_3 Reverse -252 -271 -5.01543 0.287
NP_441846.1_10 Reverse -8 -27 -20.4534 0.256
NP_442958.1_3 Forward -301 -282 -2.26216 0.293
NP_442583.1_8 Reverse -282 -301 10.3242 0.225
NP_440642.1_10 Reverse -333 -347 12.192 0.137
NP_440642.1_10 Forward -400 -386 4.8172 0.25
NP_440642.1_10 Forward -35 -21 1.37564 0.293
NP_441422.1_7 Reverse -279 -296 0.137172 0.148
NP_440667.1_9 Reverse -294 -313 14.2574 0.27
NP_442782.1_2 Forward -233 -219 11.3077 0.173
NP_442205.1_9 Reverse -72 -88 3.10679 0.195
NP_440656.1_8 Reverse -266 -285 -5.31042 0.214
NP_440720.1_5 Reverse -2 -21 10.5209 0.141
NP_441958.1_5 Forward -291 -281 1.55333 0.095
NP_440318.1_1 Reverse -329 -348 0.294447 0.296
NP_442836.1_5 Forward -93 -74 2.85105 0.248
NP_440950.1_6 Reverse -361 -380 14.1591 0.201
NP_442260.1_8 Forward -342 -323 12.6841 0.136
NP_439905.1_1 Forward -379 -366 7.09911 0.268
NP_439905.1_2 Forward -301 -287 11.3077 0.208
NP_440984.1_7 Forward -245 -231 7.47274 0.171
NP_439990.1_5 Forward -295 -282 10.8357 0.128
NP_440153.1_8 Reverse -254 -267 -3.52063 0.295
NP_443055.1_6 Reverse -249 -267 -1.84987 0.284
NP_442210.1_9 Forward -91 -73 9.36059 0.259
NP_441099.1_5 Forward -300 -281 -10.1286 0.243
NP_442002.1_9 Forward -381 -374 13.0188 0.185
NP_442013.1_1 Reverse -249 -268 9.0459 0.276
NP_441646.1_1 Forward -297 -278 -1.96717 0.298
NP_442438.1_10 Reverse -309 -323 -0.295402 0.256
NP_441000.1_6 Forward -291 -277 -4.91696 0.254
NP_442771.1_1 Forward -304 -286 -6.86402 0.169
NP_440147.1_4 Forward -292 -279 4.93583 0.142
NP_440147.1_4 Reverse -279 -292 4.44418 0.16
NP_441550.1_8 Forward -242 -232 6.86274 0.188
NP_441550.1_8 Forward -292 -282 5.87944 0.224
NP_441916.1_7 Reverse -281 -291 7.74818 0.0608
NP_441916.1_7 Forward -286 -276 1.455 0.285
NP_441041.1_4 Reverse -281 -300 -11.7019 0.251
NP_440569.1_10 Forward -389 -370 7.59119 0.231
NP_442004.1_6 Reverse -281 -295 8.06273 0.149
NP_441725.1_5 Forward -39 -29 7.05986 0.106
NP_441406.1_2 Reverse -347 -366 12.2908 0.204
NP_439966.1_7 Forward -292 -282 5.58445 0.216
NP_439966.1_7 Reverse -279 -289 4.7978 0.258
NP_442941.1_3 Reverse -282 -292 9.41981 0.0319
NP_442941.1_3 Forward -289 -279 6.96153 0.0903
NP_440289.1_2 Forward -305 -292 2.67422 0.0907
NP_440289.1_2 Reverse -290 -303 1.00259 0.141
NP_440983.1_5 Forward -368 -349 -8.85033 0.298
NP_440260.1_8 Reverse -326 -344 -4.8974 0.273
NP_440260.1_8 Forward -381 -363 -6.1757 0.287
NP_442281.1_1 Reverse -276 -290 8.65209 0.0783
NP_442281.1_1 Forward -295 -281 7.17714 0.106
NP_442281.1_1 Reverse -26 -40 2.06395 0.278
NP_439983.1_1 Forward -26 -8 15.4563 0.203
NP_442288.1_3 Reverse -328 -345 6.23369 0.279
NP_441644.1_6 Forward -240 -230 8.92768 0.0895
NP_441644.1_6 Reverse -281 -291 6.0761 0.167
NP_443049.1_6 Reverse -230 -240 13.4952 0.162
NP_443049.1_6 Forward -291 -281 12.3241 0.24
NP_442215.1_2 Reverse -216 -232 -3.08806 0.209
NP_442215.1_2 Forward -242 -226 -6.7263 0.278
NP_442029.1_6 Reverse -336 -355 6.09597 0.244
NP_442029.1_6 Reverse -2 -21 3.93269 0.274
NP_440253.1_2 Forward -290 -272 11.7205 0.0308
NP_442933.1_10 Reverse -281 -290 15.1427 0.00958
NP_442933.1_10 Forward -290 -281 7.96454 0.0937
NP_441751.2_8 Reverse -282 -296 2.85119 0.0759
NP_442554.1_8 Reverse -282 -292 6.37155 0.12
NP_442554.1_8 Reverse -232 -242 2.33998 0.274
NP_442075.1_9 Forward -33 -14 7.76679 0.276
NP_442313.1_5 Reverse -288 -307 9.63589 0.191
NP_442142.1_4 Forward -293 -280 7.88518 0.127
NP_442142.1_4 Reverse -254 -267 4.34528 0.223
NP_442292.1_1 Reverse -282 -291 8.65285 0.0335
NP_442292.1_1 Forward -289 -280 -0.196935 0.239
NP_440895.1_6 Forward -296 -283 8.86907 0.242
NP_442381.1_8 Reverse -278 -297 -7.86702 0.205
NP_443009.1_5 Reverse -370 -381 3.8931 0.274
NP_442301.1_2 Reverse -247 -266 11.405 0.163
NP_441715.1_4 Reverse -282 -292 7.55152 0.108
NP_441715.1_4 Forward -289 -279 6.37155 0.148
NP_441468.1_1 Forward -289 -282 6.13563 0.209
NP_441468.1_1 Reverse -282 -289 6.0373 0.223
NP_441468.1_1 Reverse -232 -239 4.07068 0.263
NP_441673.1_1 Forward -290 -281 1.27803 0.155
NP_441673.1_1 Reverse -281 -290 1.27803 0.155
NP_441244.1_1 Forward -139 -121 13.0972 0.294
NP_441731.1_5 Forward -89 -72 13.4119 0.258
NP_441826.1_2 Forward -296 -282 -4.7203 0.299
NP_442490.1_9 Forward -302 -283 3.24438 0.165
NP_441764.1_8 Reverse -270 -280 10.8322 0.297
NP_442868.1_6 Forward -292 -282 9.51814 0.0447
NP_442868.1_6 Reverse -279 -289 0.57002 0.217
NP_441251.1_8 Forward -170 -157 18.3007 0.254
NP_441056.1_1 Reverse -281 -300 -4.72043 0.257
NP_441612.1_2 Forward -290 -280 6.70984 0.277
NP_442427.1_8 Reverse -272 -291 5.50599 0.264
NP_441101.1_3 Forward -253 -234 12.5858 0.281
NP_441101.1_10 Forward -254 -235 -4.32711 0.277
NP_440145.1_3 Reverse -271 -290 6.98095 0.0495
NP_442542.1_2 Forward -304 -291 6.31247 0.232
NP_442113.1_10 Reverse -244 -263 -8.45701 0.282
NP_442050.1_1 Reverse -18 -37 11.2092 0.233
NP_442050.1_5 Reverse -76 -86 12.5659 0.0574
NP_442050.1_5 Reverse -279 -289 9.41933 0.193
NP_441493.2_10 Reverse -270 -289 7.27595 0.249
NP_441114.1_3 Forward -38 -29 7.57121 0.231
NP_440558.1_2 Forward -299 -280 1.86774 0.175
NP_441878.1_6 Reverse -292 -302 2.14332 0.0501
NP_441878.1_6 Forward -297 -287 0.0783647 0.152
NP_441878.1_6 Forward -303 -293 -6.60814 0.193
NP_441878.1_6 Reverse -30 -40 -7.39479 0.222
NP_441878.1_6 Forward -381 -371 -7.68978 0.255
NP_441557.1_5 Forward -290 -281 8.94785 0.0289
NP_441557.1_5 Reverse -281 -290 0.688044 0.128
NP_441557.1_8 Reverse -342 -352 13.0576 0.225
NP_441445.1_8 Forward -271 -252 -3.04881 0.277
NP_441458.1_10 Forward -299 -280 5.50599 0.216
NP_442166.1_7 Forward -391 -377 11.7993 0.19
NP_441459.1_8 Forward -387 -374 16.8339 0.286
NP_441549.1_9 Forward -306 -288 -10.3056 0.274
NP_442347.1_2 Reverse -282 -291 12.2911 0.056
NP_442347.1_2 Forward -245 -236 6.29291 0.175
NP_442645.1_2 Reverse -273 -292 -21.7317 0.29
NP_442965.1_2 Reverse -14 -33 1.86774 0.185
NP_441633.1_3 Reverse -337 -350 -4.7006 0.209
NP_440136.1_2 Forward -289 -282 6.23397 0.171
NP_440136.1_2 Reverse -282 -289 6.13563 0.193
NP_442590.1_10 Reverse -281 -300 4.12936 0.281
NP_442998.1_10 Reverse -283 -290 15.5754 0.0102
NP_440731.1_2 Forward -302 -283 8.75091 0.275
NP_440299.1_1 Forward -294 -281 16.5383 0.00987
NP_441799.1_1 Forward -244 -230 11.012 0.0629
NP_441799.1_1 Reverse -74 -88 9.43874 0.0922
NP_440256.1_1 Forward -293 -274 -2.26216 0.115
NP_440087.1_1 Reverse -362 -381 -7.08038 0.266
NP_441559.1_8 Forward -355 -341 -5.31028 0.259
NP_442785.1_9 Forward -254 -235 12.4867 0.265
NP_440695.1_5 Forward -302 -283 -1.47551 0.284
NP_441939.1_3 Reverse -282 -301 7.86593 0.188
NP_442993.1_1 Reverse -84 -100 -13.2161 0.288
NP_442386.1_9 Forward -241 -232 10.5207 0.126
NP_442386.1_9 Reverse -280 -289 5.11253 0.266
NP_441340.1_5 Forward -289 -282 6.23397 0.132
NP_441340.1_5 Reverse -282 -289 5.84064 0.208
NP_441340.1_5 Reverse -232 -239 4.07068 0.239
NP_441340.1_5 Forward -86 -79 3.97235 0.274
NP_441340.1_9 Reverse -271 -281 7.38756 0.27
NP_442484.1_2 Forward -32 -13 -1.67217 0.295
NP_442240.1_2 Reverse -282 -301 -12.9802 0.163
NP_440586.1_8 Forward -289 -282 14.69 0.026
NP_440586.1_8 Forward -239 -232 7.61025 0.227
NP_440586.1_8 Reverse -112 -119 5.93863 0.283
NP_442251.1_6 Reverse -282 -289 12.0355 0.0627
NP_442959.1_5 Forward -150 -131 7.66927 0.23
NP_441262.1_3 Forward -290 -283 14.7888 0.0223
NP_441262.1_3 Forward -87 -80 10.6589 0.0722
NP_443051.1_1 Forward -291 -282 0.884706 0.125
NP_440408.1_7 Forward -302 -283 8.84924 0.267
NP_440408.1_7 Reverse -1 -20 8.06259 0.282
NP_440408.1_7 Reverse -18 -37 7.37428 0.29
NP_440372.1_2 Forward -289 -282 6.82395 0.0854
NP_440372.1_2 Reverse -282 -289 6.52896 0.188
NP_440372.1_2 Reverse -232 -239 4.07068 0.262
NP_440316.1_10 Forward -297 -287 8.4365 0.239
NP_440316.1_10 Reverse -30 -40 7.25653 0.251
NP_439977.1_7 Reverse -270 -289 13.6666 0.262
NP_440267.1_2 Reverse -276 -290 11.4053 0.125
NP_440267.1_2 Forward -212 -198 7.07881 0.21
NP_442384.1_10 Reverse -281 -294 10.8357 0.0411
NP_442384.1_10 Forward -246 -233 2.77255 0.213
NP_441877.1_7 Reverse -276 -295 3.04693 0.218
NP_441018.1_7 Forward -91 -72 10.8159 0.194
NP_442262.1_10 Forward -289 -282 12.9205 0.0422
NP_442262.1_10 Forward -239 -232 10.6589 0.14
NP_442262.1_10 Forward -39 -32 8.8889 0.219
NP_441689.1_5 Reverse -76 -86 15.0242 0.0617
NP_441689.1_5 Reverse -279 -289 5.48612 0.251
NP_440282.1_10 Reverse -283 -302 6.09597 0.125
NP_440531.1_8 Reverse -350 -369 2.26107 0.298
NP_440487.1_1 Reverse -254 -273 -6.29373 0.239
NP_441335.1_8 Reverse -350 -369 8.65258 0.252
NP_440826.1_5 Reverse -72 -90 15.5767 0.231
NP_442065.1_2 Reverse -337 -350 20.9631 0.188
NP_442065.1_7 Reverse -222 -240 9.36059 0.17
NP_440297.1_9 Forward -39 -29 6.96153 0.161
NP_440297.1_9 Reverse -288 -298 1.16001 0.282
NP_442280.1_1 Reverse -351 -370 7.07928 0.162
NP_442280.1_10 Reverse -331 -349 9.64264 0.232
NP_441103.1_9 Forward -25 -15 12.6848 0.29
NP_440894.1_10 Reverse -334 -353 4.71934 0.244
NP_442078.1_3 Reverse -259 -278 0.883656 0.236
NP_442067.1_4 Forward -307 -288 2.85105 0.289
NP_440888.1_2 Forward -246 -232 9.6354 0.12
NP_442892.1_6 Forward -368 -349 8.45592 0.189
NP_442147.1_6 Reverse -377 -391 14.7486 0.281
NP_440491.1_1 Reverse -221 -240 9.4509 0.214
NP_441123.1_8 Forward -250 -231 14.3558 0.243
NP_441543.1_2 Forward -289 -280 11.9961 0.047
NP_441543.1_2 Reverse -282 -291 7.07956 0.131
NP_442845.1_2 Reverse -225 -239 6.19444 0.215
NP_442845.1_2 Forward -302 -288 5.70279 0.225
NP_441319.1_8 Reverse -231 -249 6.70565 0.27
NP_443064.1_6 Reverse -281 -291 8.88251 0.262
NP_443064.1_6 Reverse -237 -247 8.39772 0.292
NP_442337.1_8 Reverse -334 -353 4.32602 0.21
NP_442578.1_7 Forward -289 -282 14.6904 0.026
NP_441462.1_2 Forward -290 -280 1.25834 0.0964
NP_440519.1_6 Forward -245 -231 15.9292 0.29
NP_440519.1_8 Forward -263 -247 3.30346 0.247
NP_442204.1_1 Forward -294 -283 11.5634 0.0565
NP_441560.1_8 Reverse -288 -307 12.097 0.268
NP_440544.1_5 Forward -277 -270 13.8024 0.28
NP_441351.1_8 Forward -256 -237 2.94938 0.236
NP_440516.1_8 Forward -290 -281 0.983037 0.13
NP_440516.1_8 Reverse -231 -240 -0.590259 0.283
NP_442846.1_3 Forward -254 -235 12.7825 0.219
NP_442428.1_4 Forward -303 -284 2.26107 0.266
NP_442428.1_5 Forward -289 -282 6.13563 0.209
NP_442428.1_5 Reverse -282 -289 6.0373 0.212
NP_442428.1_5 Reverse -232 -239 4.46401 0.267
NP_442120.1_10 Reverse -323 -342 -8.85033 0.239
NP_440673.1_2 Reverse -101 -120 9.99938 0.226
NP_440673.1_3 Reverse -283 -290 12.4288 0.0426
NP_440673.1_3 Forward -238 -231 12.3305 0.0521
NP_440673.1_3 Forward -38 -31 8.98723 0.203
NP_441052.1_2 Forward -290 -280 6.76487 0.0863
NP_441052.1_2 Reverse -281 -291 1.65166 0.233
NP_442219.1_9 Forward -289 -280 8.75118 0.0681
NP_442219.1_9 Reverse -282 -291 7.96454 0.0696
NP_440436.1_4 Reverse -282 -291 7.57079 0.124
NP_440436.1_4 Forward -289 -280 6.39082 0.162
NP_441884.1_9 Reverse -251 -270 -22.8133 0.284
NP_440314.1_9 Forward -370 -351 -8.85033 0.254
NP_441719.1_4 Forward -289 -282 13.5105 0.026
NP_441719.1_4 Reverse -282 -289 6.52896 0.188
NP_441004.1_1 Reverse -2 -21 -0.295539 0.123
NP_442813.1_4 Reverse -333 -352 -8.85033 0.299
NP_443054.1_2 Forward -340 -326 14.6509 0.0722
NP_441851.1_10 Forward -291 -281 13.0581 0.0372
NP_442208.1_5 Reverse -6 -25 -9.73531 0.295
NP_442622.1_8 Reverse -293 -311 -18.8604 0.285
NP_441501.1_9 Reverse -249 -268 15.6332 0.214
NP_442856.1_5 Reverse -242 -261 17.6346 0.204
NP_442856.1_7 Forward -299 -280 -5.80207 0.287
NP_442515.1_1 Reverse -30 -44 -1.27871 0.251
NP_441683.1_7 Reverse -353 -372 -6.78538 0.272
NP_441683.1_7 Reverse -30 -49 -12.3902 0.29
NP_440593.1_3 Forward -268 -249 -7.27704 0.291
NP_440463.1_8 Forward -21 -2 5.46683 0.279
NP_440432.1_9 Forward -289 -274 1.06154 0.153
NP_440432.1_9 Reverse -294 -309 -5.03498 0.233
NP_442843.1_1 Reverse -232 -251 -10.6203 0.279
NP_442843.1_1 Forward -343 -324 -11.2103 0.286
NP_442843.1_1 Forward -387 -368 -11.8986 0.295
NP_442006.1_2 Reverse -11 -28 -16.5791 0.256
NP_442006.1_2 Reverse -30 -47 -18.1524 0.288
NP_441570.1_1 Forward -240 -222 -17.1888 0.267
NP_441078.1_4 Forward -302 -293 6.09625 0.0863
NP_441078.1_4 Reverse -293 -302 5.99792 0.0932
NP_441078.1_4 Reverse -281 -290 0.0980582 0.205
NP_441078.1_4 Forward -290 -281 0.0980582 0.205
NP_442729.1_5 Reverse -230 -240 14.3364 0.22
NP_442729.1_6 Forward -265 -247 18.6599 0.108
NP_442348.1_2 Reverse -351 -360 7.76787 0.28
NP_442443.1_1 Reverse -363 -382 4.81767 0.157
NP_441432.1_8 Forward -291 -282 7.27622 0.101
NP_441432.1_8 Reverse -30 -39 3.83464 0.243
NP_442320.1_8 Reverse -275 -289 -6.39192 0.283
NP_440760.1_1 Reverse -371 -390 -22.0267 0.248
NP_440760.1_1 Forward -290 -271 -22.9117 0.274
NP_442797.1_1 Forward -271 -252 -0.0988766 0.223
NP_440913.1_1 Forward -292 -274 13.3922 0.139
NP_440281.1_6 Forward -218 -199 10.5209 0.268
NP_442489.1_7 Reverse -281 -290 7.57121 0.057
NP_442489.1_7 Forward -290 -281 0.589713 0.17
NP_442489.1_7 Forward -380 -371 -2.06522 0.288
NP_440559.1_1 Forward -289 -280 14.4544 0.0174
NP_440559.1_1 Reverse -282 -291 7.76787 0.0918
NP_440559.1_1 Reverse -79 -88 4.62128 0.24
NP_441659.2_8 Reverse -281 -291 6.27322 0.0797
NP_442849.1_1 Reverse -5 -19 12.4876 0.201
NP_442849.1_1 Reverse -18 -32 11.7993 0.203
NP_442849.1_1 Forward -350 -336 10.816 0.203
NP_439956.1_7 Forward -93 -74 3.53937 0.257
NP_442008.1_6 Forward -124 -105 22.4189 0.0056
NP_442346.1_5 Forward -291 -281 7.05986 0.183
NP_442346.1_5 Reverse -280 -290 4.69992 0.276
NP_440486.1_6 Forward -303 -284 6.58763 0.283
NP_440459.1_2 Reverse -229 -246 7.217 0.299
NP_440847.1_3 Reverse -256 -270 12.0937 0.254
NP_441833.1_4 Reverse -282 -289 6.52896 0.0924
NP_441833.1_4 Forward -289 -282 6.23397 0.163
NP_441329.1_6 Forward -210 -191 0.333799 0.258
NP_442060.1_5 Forward -393 -374 11.1109 0.29
NP_442162.1_9 Forward -86 -79 9.28223 0.0694
NP_442162.1_9 Forward -289 -282 6.62729 0.142
NP_442162.1_9 Reverse -282 -289 6.52896 0.178
NP_440671.1_4 Forward -296 -282 7.47274 0.217
NP_440224.1_1 Forward -301 -282 6.78429 0.116
NP_442140.1_3 Forward -239 -229 8.1415 0.123
NP_442140.1_3 Reverse -232 -242 3.81494 0.278
NP_440875.1_9 Reverse -283 -293 8.37203 0.233
NP_441813.1_5 Forward -292 -282 8.4365 0.0432
NP_441813.1_5 Reverse -279 -289 7.74818 0.0611
NP_441813.1_5 Reverse -76 -86 2.24165 0.194
NP_440594.1_6 Forward -377 -358 6.39016 0.258
NP_440590.1_4 Reverse -282 -295 3.16588 0.0756
NP_440590.1_4 Reverse -79 -92 -5.88057 0.293
NP_442497.1_10 Reverse -282 -291 0.589713 0.153
NP_442497.1_10 Forward -289 -280 -1.18024 0.256
NP_440821.1_4 Forward -292 -282 -0.314959 0.251
NP_441239.1_9 Forward -42 -30 6.43049 0.189
NP_441239.1_9 Reverse -76 -88 3.2839 0.289
NP_441951.1_6 Reverse -248 -267 9.73422 0.253
NP_441892.1_1 Forward -305 -288 -4.28772 0.258
NP_441892.1_1 Reverse -278 -295 -5.27103 0.276
NP_441567.1_4 Forward -387 -368 6.4893 0.281
NP_442809.1_6 Reverse -72 -91 6.09597 0.256
NP_440546.1_4 Reverse -231 -241 8.88251 0.166
NP_440546.1_4 Forward -87 -77 8.00989 0.209
NP_440462.1_6 Forward -292 -282 6.37155 0.118
NP_440462.1_6 Reverse -76 -86 3.51995 0.242
NP_442611.1_4 Reverse -253 -272 16.1257 0.225
NP_440868.1_4 Reverse -227 -239 2.20226 0.161
NP_440868.1_4 Forward -244 -232 -0.157684 0.248
NP_442402.1_4 Forward -89 -70 -3.63955 0.219
NP_442402.1_4 Forward -23 -4 -8.94939 0.285
NP_442039.1_4 Forward -86 -79 10.8555 0.109
NP_442039.1_7 Reverse -233 -243 9.91146 0.257
NP_442039.1_7 Forward -118 -108 7.64985 0.273
NP_442679.1_1 Forward -351 -332 -5.99873 0.298
NP_442696.1_6 Reverse -254 -273 -12.9802 0.256
NP_442837.1_3 Reverse -282 -289 12.1338 0.0702
NP_442837.1_3 Forward -289 -282 6.0373 0.25
NP_440160.1_2 Forward -303 -284 -5.50708 0.274
NP_442053.1_1 Reverse -281 -290 6.8829 0.111
NP_442053.1_1 Forward -240 -231 3.83464 0.285
NP_440505.1_3 Forward -292 -282 9.51814 0.122
NP_440914.1_1 Reverse -231 -241 8.41992 0.191
NP_440914.1_1 Reverse -281 -291 7.24882 0.242
NP_442931.1_2 Forward -229 -210 25.9588 0.00257
NP_442931.1_4 Forward -264 -245 21.3373 0.0235
NP_442931.1_5 Forward -355 -336 23.8939 0.00792
NP_442533.1_6 Forward -290 -281 5.40793 0.14
NP_442533.1_6 Reverse -287 -296 1.96635 0.28
NP_442541.1_10 Reverse -335 -349 3.24392 0.254
NP_442322.1_9 Forward -32 -14 11.3264 0.251
NP_441482.1_7 Forward -296 -282 8.55439 0.0162
NP_441482.1_7 Reverse -287 -301 -9.63684 0.208
NP_441028.1_6 Forward -245 -235 12.6642 0.183
NP_441028.1_6 Forward -26 -16 3.71617 0.281
NP_440116.1_8 Reverse -232 -251 -9.34199 0.276
NP_441527.1_4 Forward -210 -191 -5.49121 0.202
NP_441527.1_4 Forward -170 -151 -12.5576 0.291
NP_441527.1_4 Reverse -24 -43 -12.8441 0.294
NP_440115.1_6 Forward -293 -283 16.008 0.0325
NP_440115.1_6 Forward -90 -80 6.8632 0.167
NP_441972.1_5 Reverse -282 -301 -4.6221 0.211
NP_441106.1_1 Forward -121 -112 2.458 0.283
NP_442306.1_10 Reverse -366 -385 -11.8986 0.154
NP_441286.1_1 Forward -291 -279 -5.76255 0.223
NP_441286.1_1 Reverse -280 -292 -6.05754 0.245
NP_442674.1_3 Reverse -223 -242 4.42355 0.291
NP_441930.1_2 Reverse -30 -40 13.5497 0.24
NP_440886.1_7 Forward -241 -231 5.09279 0.201
NP_442614.1_2 Reverse -237 -251 7.57108 0.271
NP_442382.1_7 Reverse -218 -237 9.0459 0.229
NP_442401.1_2 Reverse -230 -249 7.37347 0.266
NP_440907.2_4 Reverse -153 -172 8.84726 0.299
NP_442264.1_2 Reverse -277 -294 4.6604 0.295
NP_441021.1_1 Reverse -282 -301 5.60432 0.0704
NP_440841.1_4 Reverse -29 -48 -4.03212 0.185
NP_441626.1_2 Forward -289 -282 6.13563 0.177
NP_441626.1_2 Reverse -282 -289 5.93897 0.231
NP_442794.1_1 Forward -294 -282 10.2654 0.0721
NP_442615.1_1 Forward -299 -281 -6.66736 0.256
NP_441836.1_2 Reverse -377 -396 5.60432 0.123
NP_441193.1_1 Reverse -365 -384 15.5349 0.229
NP_440358.1_8 Reverse -309 -328 6.29264 0.189
NP_440814.1_8 Reverse -20 -39 -1.08219 0.293
NP_440467.1_8 Reverse -18 -37 11.0125 0.249
NP_440114.1_10 Forward -87 -73 12.1926 0.0885
NP_440114.1_10 Reverse -31 -45 7.57108 0.231
NP_442698.1_10 Reverse -259 -278 -0.885524 0.297
NP_442698.1_10 Reverse -364 -383 -1.08219 0.297
NP_441510.2_7 Forward -240 -226 12.192 0.28
NP_441510.2_7 Reverse -372 -386 9.24208 0.292
NP_442635.1_9 Forward -291 -272 14.9786 0.262
NP_441531.1_6 Reverse -257 -270 12.704 0.254
NP_439910.1_2 Reverse -273 -290 -14.0225 0.177
NP_440457.1_1 Forward -294 -282 7.31547 0.105
NP_440457.1_1 Reverse -27 -39 -0.157684 0.254
NP_441801.1_4 Forward -358 -348 11.1898 0.231
NP_442680.1_5 Reverse -18 -37 2.51449 0.237
NP_442680.1_5 Reverse -17 -36 -0.806985 0.294
NP_440473.1_5 Forward -303 -284 13.6675 0.248
NP_442509.1_9 Reverse -371 -381 11.3859 0.134
NP_442509.1_9 Forward -337 -327 8.92768 0.192
NP_443037.1_8 Reverse -300 -319 10.9142 0.242
NP_441885.1_5 Forward -290 -280 10.2065 0.012
NP_441885.1_5 Reverse -281 -291 1.35667 0.11
NP_440649.2_8 Reverse -14 -28 8.75105 0.282
NP_442341.1_5 Forward -352 -333 11.3075 0.284
NP_442341.1_7 Reverse -280 -294 1.17956 0.297
NP_442341.1_9 Forward -242 -228 5.70218 0.258
NP_443000.1_7 Forward -292 -282 10.2065 0.0355
NP_443000.1_7 Reverse -279 -289 9.41981 0.0437
NP_440507.2_3 Reverse -284 -303 9.83173 0.216
NP_441842.1_10 Forward -387 -373 8.55439 0.218
NP_440275.1_3 Forward -292 -282 5.5849 0.14
NP_440091.1_1 Reverse -277 -289 1.7106 0.197
NP_441902.1_1 Reverse -363 -382 11.11 0.282
NP_441902.1_3 Forward -63 -53 11.7184 0.293
NP_442451.1_2 Reverse -363 -382 2.45773 0.143
NP_442451.1_2 Forward -369 -350 -8.06369 0.241
NP_441207.1_7 Forward -218 -204 8.77134 0.282
NP_442495.1_2 Reverse -284 -303 11.6025 0.266
NP_440149.1_8 Reverse -281 -300 -4.72043 0.213
NP_440149.1_8 Reverse -371 -390 -5.40875 0.226
NP_441105.1_3 Forward -307 -288 5.60432 0.0669
NP_440216.1_1 Forward -290 -276 -11.6035 0.203
NP_440216.1_9 Reverse -164 -173 11.4061 0.267
NP_440172.1_1 Forward -290 -280 7.55152 0.0761
NP_440172.1_1 Forward -380 -370 2.83163 0.264
NP_442015.1_10 Forward -294 -281 1.78924 0.204
NP_441226.1_7 Forward -239 -232 11.2485 0.0971
NP_441111.1_7 Reverse -282 -290 8.86921 0.0589
NP_441766.1_2 Forward -290 -281 8.1612 0.0645
NP_440416.1_9 Reverse -334 -353 -1.37718 0.0652
NP_440416.1_9 Forward -241 -222 -11.3086 0.149
NP_440416.1_9 Reverse -286 -305 -12.2919 0.156
NP_440416.1_9 Forward -297 -278 -16.5201 0.216
NP_440416.1_9 Reverse -230 -249 -18.1918 0.253
NP_440416.1_9 Forward -22 -3 -20.2567 0.283
NP_440416.1_9 Forward -367 -348 -21.3384 0.294
NP_442309.1_2 Reverse -168 -187 20.5506 0.213
NP_441019.1_9 Forward -20 -1 17.1082 0.181
NP_442154.1_1 Forward -265 -247 -7.35568 0.141
NP_440261.1_5 Reverse -282 -295 -12.4687 0.297
NP_440988.1_10 Forward -242 -228 7.41596 0.216
NP_440988.1_10 Reverse -229 -243 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTCCGTACCCACCGTTTGGGCGATTTTCTGCACCGCCTCAAAATCCCCGGGGCTAGCAAAGGGAAAACCCGCTTCGATAATATCCACCCCTAAACGGGCTAGAGCCCTGGCGATCGATAGTTTTTCTTCCACGGTCAGGGTGGCTCCGGGGGACTGTTCCCCATCGCGAAGCGTGGTGTCGAAAATCAAAATACGATCAACAGGACTATTCATAATAAACGCACCTTTTCAAGGGTGAAAAAGACACAGATAGATTCTGATTGTATCTTGTCTATTTAGACGTTGGCATACTTTGAAGAGGTAAAATCGGTAGCGATTGGTTTCCCCTTAATGCGTTAAGGAGTAATTTGCTTTATCGTCCCATTGCCCTTTCTTCTCCCCCTCTGCTTCCCTAGCCC

CDS

ATGAGCCATAGCCGCTTTAAGTCCGCTAAGTCCGCCATGCGCAAGTTGAAAACCGAACAACGGAAGTTTGGCGATCGGGTTTCCCAGCACACCTCCCCCAGGGTTAACCGCTGGTTCAAATGGATGGCTCCGGGACTGTTTGTCAAACGTTGGATGGTGATCAGCGCCGTTGGTTTGACTTTAATGTTTTTGGGCTTGGCCATTTGGGTTAAGTTGACCCCCATTTTTCGCATTACGGAATTTGTTTCCGATACCCTGGGGTTTTTGACCAATCTTTTGCCCAACTATGTTTCTGGGCCCCTGATTTTGGCCTTGGGACTATTTTTTGTCTTTTGGGGTCAAAGTCGCACCGTTGGTTCTATTTCCGAGGTGTTGCAACCGGATAACGACCAGGAGTTGGTGGACGTGCTACTGGCCCACCGTCGCCTTAATAAGGGGGCTAAAATTGTCGTAGTGGGGGGAGGTACGGGCTTATCGACTCTTTTACGGGGCTTGAAACATTACAGCGCTAACATTACTGCCATTGTTACCGTGGCCGATGACGGTGGTTCCTCCGGGCGTTTACGACGGGAAATGGGTATGTTGCCCCCAGGGGATATTCGCAATTGCATTGGGGCCCTGGCGGACGAAGAAAAGTTATTAACAGAGTTGTTTCAATACCGTTTTAAAGCTGGGGATGGGCTGTCGGGCCACAGTTTTGGTAATTTGTTCCTCACTGCCATGGCGGAAATTACCGGAGATTTGGAAATGGCGGCGATCGCCTGCTCGAAGGTTTTAGCGGTGCGGGGGAAGGTGTTGCCAGCCACCCTGGACGATGTCAAATTGTGGGCAGAAATGGAGGACGGGCGCTATGTGGAGGGGGAATCCAATATCCCTGAAGCCCAAGGACGCATTCGGCGCATCGGTTGTTTACCAGAATCCCCTAAGGCTTTGCCAGCGGTGCTCAAGGCCATTAAAGCGGCCGACTATATCATCATTGGCCCGGGCAGTTTATACACCAGCATTTTGCCTAATTTGCTCATTCCCGAAATTCAAACGGCGATCGCCAAGGCCAAGGTGCCCCGCATTTATATCTGCAATGTGATGACCCAACCAGGGGAAACGGATAATTACACTGTCTCAGACCATTTAACGGCGATCGATCAAGTCTCTTCGGCAAGGCTCTACGATGCTGTGCTGGTGCAGAGAAATCCCCCTTCTGCCCCGGTGTTGAAAAAATATGCCGCCGAAAATTCCCATCCCGTTTACCTGGACCGGCAAGCAGTGATCGAAAAGGGTTGCCGCATTGTGCTAGCCAATGTGATGCAGGAGGATGAAAAAAGCCATCAGGTACGCCATGACCCCCAACGCTTAGCCCGGGTATTAATGCGCTGGTATGGCGGTCAGTAA

Protein

MSHSRFKSAKSAMRKLKTEQRKFGDRVSQHTSPRVNRWFKWMAPGLFVKRWMVISAVGLTLMFLGLAIWVKLTPIFRITEFVSDTLGFLTNLLPNYVSGPLILALGLFFVFWGQSRTVGSISEVLQPDNDQELVDVLLAHRRLNKGAKIVVVGGGTGLSTLLRGLKHYSANITAIVTVADDGGSSGRLRREMGMLPPGDIRNCIGALADEEKLLTELFQYRFKAGDGLSGHSFGNLFLTAMAEITGDLEMAAIACSKVLAVRGKVLPATLDDVKLWAEMEDGRYVEGESNIPEAQGRIRRIGCLPESPKALPAVLKAIKAADYIIIGPGSLYTSILPNLLIPEIQTAIAKAKVPRIYICNVMTQPGETDNYTVSDHLTAIDQVSSARLYDAVLVQRNPPSAPVLKKYAAENSHPVYLDRQAVIEKGCRIVLANVMQEDEKSHQVRHDPQRLARVLMRWYGGQ