Your browser is old and dusty. Try Google Chrome!

Details for sll0141

ORF sll0141
Accession NP_441885.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -303 -289 0.196253 0.215
NP_440795.1_7 Forward -303 -296 14.6904 0.0123
NP_440795.1_7 Reverse -296 -303 14.6904 0.0123
NP_440795.1_7 Reverse -168 -175 6.92228 0.26
NP_441418.1_6 Reverse -295 -314 -28.4182 0.205
NP_440815.1_2 Forward -368 -354 13.4703 0.234
NP_442272.1_2 Forward -125 -106 9.31004 0.29
NP_440897.1_6 Reverse -295 -314 7.37347 0.0841
NP_441453.1_1 Forward -311 -293 4.63995 0.258
NP_441453.1_4 Reverse -295 -303 16.539 0.00633
NP_441453.1_4 Forward -304 -296 16.539 0.00633
NP_442151.1_6 Forward -304 -290 17.6008 0.00997
NP_441818.1_1 Forward -303 -292 13.1362 0.0861
NP_441818.1_9 Reverse -347 -366 -10.9153 0.299
NP_440226.1_1 Forward -304 -285 10.4225 0.0622
NP_440226.1_1 Reverse -295 -314 6.88262 0.118
NP_440259.1_4 Reverse -207 -221 17.9873 0.0912
NP_440996.1_5 Forward -336 -327 15.4627 0.195
NP_442173.1_1 Forward -303 -295 15.4574 0.00633
NP_442173.1_1 Reverse -296 -304 15.4574 0.00633
NP_442752.1_4 Forward -304 -297 13.8055 0.0199
NP_442752.1_4 Reverse -295 -302 13.8055 0.0199
NP_443027.1_4 Reverse -293 -303 13.1564 0.0521
NP_443027.1_4 Forward -306 -296 11.8781 0.0872
NP_439997.1_10 Reverse -345 -364 16.5182 0.282
NP_442975.1_10 Forward -308 -294 4.03056 0.249
NP_440784.1_7 Forward -303 -296 15.9687 0.0123
NP_440784.1_7 Reverse -296 -303 15.9687 0.0123
NP_442861.1_1 Reverse -240 -259 9.63589 0.295
NP_440061.1_9 Forward -306 -292 18.1901 0.0106
NP_440878.1_9 Reverse -285 -304 1.76941 0.177
NP_442062.1_8 Reverse -295 -305 19.4496 0.000558
NP_442062.1_8 Forward -304 -294 17.3846 0.00193
NP_441859.1_3 Forward -305 -286 3.14526 0.249
NP_441802.1_1 Forward -225 -206 8.55425 0.22
NP_440304.1_4 Reverse -293 -303 9.91146 0.051
NP_440304.1_4 Forward -306 -296 1.84832 0.299
NP_442242.1_4 Forward -303 -296 14.3954 0.0124
NP_442242.1_4 Reverse -296 -303 14.3954 0.0124
NP_441208.1_1 Reverse -168 -187 -5.70374 0.284
NP_441208.1_9 Reverse -292 -306 5.70279 0.262
NP_441594.1_6 Forward -198 -179 0.294447 0.289
NP_442110.1_7 Forward -189 -175 4.42448 0.201
NP_440856.1_4 Forward -311 -292 0.196116 0.167
NP_441083.1_3 Reverse -166 -176 13.7459 0.195
NP_441083.1_5 Forward -304 -294 20.3345 0.00053
NP_441083.1_5 Reverse -295 -305 11.3864 0.0159
NP_442827.1_8 Reverse -287 -306 4.22689 0.138
NP_441149.1_9 Forward -269 -250 -2.06626 0.291
NP_441434.1_7 Forward -302 -288 4.22782 0.225
NP_441738.1_2 Forward -302 -295 15.28 0.0102
NP_441738.1_2 Reverse -297 -304 15.28 0.0102
NP_441558.1_5 Reverse -293 -312 9.3409 0.124
NP_440209.1_1 Reverse -295 -303 18.1123 0.00295
NP_440209.1_1 Forward -304 -296 18.1123 0.00295
NP_442889.1_8 Forward -307 -293 13.5686 0.0588
NP_442889.1_8 Forward -179 -165 2.94893 0.295
NP_440410.1_10 Forward -360 -341 6.29264 0.199
NP_440447.1_6 Reverse -162 -180 0.904127 0.274
NP_441713.1_1 Reverse -289 -308 -5.21209 0.113
NP_442675.1_4 Forward -306 -288 -11.4856 0.298
NP_441770.1_4 Forward -169 -150 -11.2103 0.29
NP_440178.1_7 Forward -305 -286 -22.2233 0.258
NP_441716.1_1 Forward -304 -290 4.81781 0.248
NP_441716.1_1 Reverse -295 -309 4.32615 0.256
NP_442111.1_4 Reverse -294 -308 19.1741 0.00447
NP_440906.1_5 Forward -303 -296 15.8704 0.0124
NP_440906.1_5 Reverse -296 -303 15.8704 0.0124
NP_440438.2_8 Forward -299 -280 1.76941 0.262
NP_441209.1_8 Reverse -263 -281 16.9788 0.0793
NP_440747.1_10 Reverse -292 -304 7.4138 0.00422
NP_440747.1_10 Forward -307 -295 7.21714 0.00643
NP_441130.1_10 Forward -306 -292 9.14437 0.128
NP_441130.1_10 Reverse -293 -307 8.84938 0.131
NP_441486.1_1 Forward -307 -293 -3.93365 0.184
NP_441486.1_1 Reverse -292 -306 -4.03198 0.186
NP_442634.1_4 Forward -306 -292 -3.24533 0.161
NP_440403.1_4 Reverse -286 -305 -7.17871 0.237
NP_442848.1_1 Reverse -289 -303 -1.5737 0.263
NP_442848.1_5 Forward -183 -165 4.24738 0.276
NP_441012.1_4 Forward -359 -346 6.31247 0.282
NP_443018.1_3 Forward -303 -296 14.8871 0.0123
NP_443018.1_3 Reverse -296 -303 14.8871 0.0123
NP_441316.1_7 Forward -306 -291 -3.06836 0.273
NP_441634.1_8 Reverse -165 -179 0.491246 0.228
NP_441634.1_8 Forward -306 -292 -2.95034 0.295
NP_441634.1_8 Reverse -293 -307 -2.95034 0.295
NP_440376.1_1 Forward -304 -295 19.4693 0.000692
NP_440376.1_1 Reverse -295 -304 19.4693 0.000692
NP_441857.1_5 Reverse -288 -306 7.00065 0.189
NP_441588.1_4 Forward -302 -292 6.37155 0.2
NP_442687.1_7 Forward -305 -295 15.8113 0.0125
NP_442687.1_7 Reverse -294 -304 8.92815 0.0994
NP_441077.1_6 Forward -88 -72 2.80187 0.276
NP_441422.1_7 Forward -306 -289 8.00365 0.0992
NP_442658.1_1 Forward -306 -296 17.0891 0.00615
NP_442658.1_1 Reverse -293 -303 9.616 0.147
NP_442496.1_5 Reverse -269 -287 4.54237 0.289
NP_441414.1_9 Forward -304 -285 6.68596 0.0378
NP_441414.1_9 Reverse -295 -314 -0.688862 0.0942
NP_441958.1_5 Forward -305 -295 12.2714 0.00183
NP_441958.1_5 Reverse -294 -304 12.2714 0.00183
NP_442836.1_5 Reverse -289 -308 10.7175 0.104
NP_439905.1_1 Forward -303 -290 15.3589 0.0955
NP_439905.1_1 Reverse -296 -309 8.27909 0.234
NP_439905.1_1 Forward -360 -347 7.19745 0.264
NP_440984.1_7 Reverse -290 -304 12.1926 0.122
NP_439990.1_5 Reverse -290 -303 18.8988 0.0109
NP_442690.1_1 Forward -154 -135 -15.4385 0.28
NP_442911.1_2 Reverse -285 -304 7.37428 0.025
NP_442911.1_2 Forward -314 -295 -0.688862 0.0775
NP_441591.1_10 Forward -306 -287 6.29264 0.286
NP_442119.1_9 Reverse -294 -313 10.6192 0.248
NP_440993.1_4 Forward -176 -159 9.47861 0.216
NP_440138.1_6 Forward -303 -284 1.86696 0.273
NP_441099.1_5 Forward -314 -295 -1.08219 0.102
NP_442002.1_9 Forward -305 -298 10.7572 0.185
NP_440809.1_9 Forward -313 -295 -8.04399 0.225
NP_441294.1_7 Forward -308 -294 12.2263 0.107
NP_441294.1_7 Forward -180 -166 10.7864 0.171
NP_441000.1_5 Forward -260 -241 3.9319 0.286
NP_441000.1_6 Reverse -294 -308 6.29277 0.0933
NP_440605.1_4 Forward -314 -295 12.9884 0.25
NP_440147.1_4 Forward -306 -293 19.3905 0.00277
NP_440147.1_4 Reverse -293 -306 8.47575 0.0504
NP_441175.1_2 Reverse -75 -94 6.09597 0.276
NP_441550.1_8 Reverse -293 -303 16.7941 0.00906
NP_441550.1_8 Forward -306 -296 8.82935 0.112
NP_441916.1_7 Reverse -295 -305 18.4663 0.00144
NP_441916.1_7 Forward -304 -294 10.3048 0.0261
NP_441916.1_10 Reverse -261 -280 4.12936 0.223
NP_441041.1_4 Reverse -257 -276 -13.3736 0.285
NP_441041.1_7 Forward -307 -295 8.48655 0.135
NP_442396.1_5 Reverse -291 -304 11.9173 0.0913
NP_442396.1_5 Forward -308 -295 8.57408 0.153
NP_440703.1_9 Forward -361 -348 12.0151 0.192
NP_441725.1_5 Forward -303 -293 9.02648 0.0553
NP_441725.1_5 Reverse -296 -306 2.04498 0.115
NP_439966.1_7 Forward -306 -296 17.9741 0.00631
NP_439966.1_7 Reverse -293 -303 14.8275 0.0177
NP_439966.1_9 Forward -68 -59 3.7363 0.253
NP_439966.1_9 Forward -306 -297 0.884706 0.253
NP_439966.1_9 Reverse -293 -302 0.884706 0.253
NP_442941.1_3 Forward -303 -293 10.9931 0.0116
NP_442941.1_3 Reverse -296 -306 10.7964 0.0116
NP_442941.1_5 Reverse -191 -205 14.9069 0.272
NP_440289.1_2 Forward -307 -294 11.1307 0.0212
NP_440289.1_2 Reverse -292 -305 -4.60227 0.29
NP_440983.1_5 Forward -367 -348 -6.68705 0.278
NP_442281.1_1 Forward -181 -167 1.96562 0.282
NP_440437.1_1 Forward -310 -291 -1.96717 0.207
NP_442012.1_2 Reverse -293 -312 4.62101 0.216
NP_441556.1_10 Forward -310 -296 10.5138 0.267
NP_443030.1_1 Forward -132 -115 7.02034 0.277
NP_441644.1_6 Forward -304 -294 17.3841 0.00127
NP_441644.1_6 Reverse -295 -305 10.1076 0.0628
NP_442215.1_2 Reverse -171 -187 -1.80975 0.189
NP_442215.1_2 Forward -178 -162 -5.93965 0.262
NP_440253.1_2 Reverse -295 -313 11.5239 0.031
NP_440253.1_2 Forward -304 -286 0.510803 0.184
NP_440929.1_8 Forward -304 -295 19.2726 0.000701
NP_440929.1_8 Reverse -295 -304 19.2726 0.000701
NP_440780.1_1 Forward -296 -277 8.6416 0.274
NP_442933.1_10 Forward -304 -295 17.601 0.00325
NP_442933.1_10 Reverse -295 -304 17.601 0.00325
NP_440891.1_8 Reverse -211 -230 13.7878 0.269
NP_441751.2_8 Forward -303 -289 2.65453 0.0782
NP_441751.2_8 Reverse -296 -310 -3.147 0.134
NP_442554.1_4 Reverse -246 -265 10.0292 0.277
NP_442554.1_8 Forward -303 -293 18.0729 0.00543
NP_442554.1_8 Reverse -296 -306 14.1397 0.0144
NP_441762.1_7 Forward -305 -293 11.8387 0.0142
NP_441762.1_7 Reverse -294 -306 2.98891 0.0676
NP_442313.1_5 Forward -276 -257 5.50599 0.256
NP_442142.1_4 Reverse -292 -305 6.80355 0.154
NP_442142.1_4 Forward -307 -294 5.91857 0.178
NP_442292.1_1 Forward -303 -294 18.486 0.00229
NP_442292.1_1 Reverse -296 -305 9.63616 0.0183
NP_442476.1_6 Reverse -296 -310 11.3077 0.056
NP_442476.1_6 Forward -303 -289 11.0127 0.0601
NP_443009.1_2 Forward -302 -283 0.982764 0.216
NP_443009.1_5 Reverse -294 -305 18.3477 0.00265
NP_441715.1_4 Reverse -296 -306 18.8596 0.00741
NP_441715.1_4 Forward -303 -293 7.84651 0.107
NP_440015.1_9 Forward -304 -286 5.23069 0.142
NP_441448.1_1 Reverse -236 -255 4.42435 0.279
NP_440183.1_9 Reverse -160 -179 -21.1417 0.296
NP_440464.1_8 Forward -372 -359 17.3249 0.299
NP_441468.1_1 Forward -303 -296 15.8704 0.0124
NP_441468.1_1 Reverse -296 -303 15.8704 0.0124
NP_441015.1_10 Reverse -290 -309 -4.81876 0.212
NP_441015.1_10 Reverse -347 -366 -10.0303 0.282
NP_441673.1_1 Forward -304 -295 20.8459 0.000698
NP_441673.1_1 Reverse -295 -304 20.8459 0.000698
NP_441876.1_9 Reverse -338 -348 12.0743 0.267
NP_441826.1_2 Reverse -289 -303 -4.13031 0.292
NP_442063.1_2 Forward -263 -244 6.4893 0.0795
NP_441764.1_8 Forward -223 -213 11.5021 0.284
NP_442868.1_6 Reverse -293 -303 17.4829 0.012
NP_442868.1_6 Forward -306 -296 10.3048 0.038
NP_442719.1_2 Forward -262 -244 1.19838 0.162
NP_442677.1_3 Forward -62 -43 0.982764 0.223
NP_441612.1_2 Forward -304 -294 8.54929 0.21
NP_442559.1_3 Reverse -82 -101 7.37428 0.291
NP_442427.1_10 Reverse -243 -262 7.76679 0.266
NP_442808.1_1 Forward -305 -295 18.4657 0.00201
NP_442808.1_1 Reverse -294 -304 8.63269 0.0481
NP_442775.1_1 Forward -178 -159 9.93088 0.293
NP_442542.1_2 Forward -306 -293 8.37742 0.156
NP_442542.1_2 Forward -191 -178 7.59077 0.176
NP_442505.1_4 Forward -337 -318 16.9124 0.168
NP_442050.1_5 Reverse -293 -303 15.6142 0.01
NP_442050.1_5 Forward -306 -296 6.96107 0.27
NP_440558.1_2 Forward -69 -50 -7.17871 0.289
NP_441878.1_6 Forward -305 -295 10.4031 0.0176
NP_441878.1_6 Reverse -294 -304 10.4031 0.0176
NP_441036.1_8 Forward -305 -295 17.7779 0.000554
NP_441036.1_8 Reverse -294 -304 8.33817 0.174
NP_441557.1_5 Forward -304 -295 19.9609 0.000699
NP_441557.1_5 Reverse -295 -304 19.9609 0.000699
NP_441445.1_1 Reverse -286 -305 8.16093 0.122
NP_442066.2_9 Reverse -291 -304 19.7838 0.00844
NP_442066.2_9 Forward -308 -295 10.934 0.154
NP_441433.1_2 Forward -364 -345 13.1758 0.277
NP_441458.1_10 Reverse -76 -95 4.42435 0.23
NP_441564.1_10 Reverse -299 -318 2.3594 0.287
NP_442183.1_1 Forward -304 -290 10.521 0.0829
NP_442183.1_9 Forward -238 -228 10.6981 0.296
NP_440190.1_5 Reverse -234 -252 13.3922 0.254
NP_440276.1_8 Reverse -332 -351 9.43923 0.244
NP_442347.1_2 Forward -303 -294 12.4878 0.056
NP_442347.1_2 Reverse -296 -305 11.1111 0.056
NP_442645.1_2 Reverse -287 -306 -21.0434 0.29
NP_441037.1_4 Reverse -293 -303 9.55921 0.21
NP_441037.1_4 Forward -306 -296 6.92787 0.237
NP_440151.1_5 Reverse -346 -365 3.53937 0.288
NP_441633.1_3 Forward -306 -293 15.4572 0.0103
NP_441633.1_3 Reverse -293 -306 1.39592 0.109
NP_441633.1_3 Reverse -178 -191 -5.58558 0.236
NP_441633.1_3 Reverse -332 -345 -6.96221 0.283
NP_441633.1_6 Reverse -104 -123 6.88262 0.276
NP_440136.1_2 Forward -303 -296 15.9687 0.0123
NP_440136.1_2 Reverse -296 -303 15.9687 0.0123
NP_442998.1_5 Forward -89 -79 7.55152 0.289
NP_442998.1_10 Forward -302 -295 15.5754 0.0102
NP_442998.1_10 Reverse -297 -304 15.5754 0.0102
NP_440299.1_1 Forward -308 -295 14.7683 0.0223
NP_440299.1_1 Reverse -291 -304 12.5067 0.0369
NP_441799.1_1 Reverse -291 -305 15.1419 0.0203
NP_441799.1_1 Forward -308 -294 11.307 0.0591
NP_441007.1_10 Reverse -290 -303 11.1307 0.0646
NP_440256.1_1 Reverse -292 -311 -1.37718 0.103
NP_441559.1_8 Forward -309 -295 10.6193 0.0574
NP_440915.1_6 Forward -308 -294 9.43936 0.0418
NP_440915.1_6 Reverse -291 -305 3.44117 0.101
NP_441704.1_8 Reverse -284 -303 17.0099 0.0736
NP_440748.1_5 Reverse -154 -173 -2.65548 0.281
NP_441464.1_8 Forward -304 -290 6.6861 0.226
NP_441464.1_10 Reverse -356 -370 11.406 0.22
NP_442386.1_9 Forward -305 -296 15.7322 0.0144
NP_442386.1_9 Reverse -294 -303 13.8639 0.0289
NP_441340.1_5 Forward -303 -296 15.6737 0.0124
NP_441340.1_5 Reverse -296 -303 15.6737 0.0124
NP_442484.1_2 Forward -366 -347 0.0977854 0.252
NP_442240.1_1 Reverse -172 -191 5.60352 0.264
NP_440161.1_3 Reverse -293 -312 10.9142 0.221
NP_440586.1_1 Forward -239 -220 -2.65548 0.256
NP_440586.1_8 Forward -303 -296 13.2151 0.026
NP_440586.1_8 Reverse -296 -303 13.2151 0.026
NP_442251.1_6 Forward -303 -296 15.2804 0.0124
NP_442251.1_6 Reverse -296 -303 15.2804 0.0124
NP_442959.1_4 Reverse -248 -267 9.83255 0.216
NP_441262.1_3 Reverse -295 -302 14.7888 0.0223
NP_441262.1_3 Forward -304 -297 14.7888 0.0223
NP_440027.1_3 Forward -189 -171 1.78836 0.295
NP_443051.1_1 Reverse -294 -303 10.4228 0.00754
NP_443051.1_1 Forward -305 -296 10.4228 0.00754
NP_441232.1_10 Forward -315 -296 5.89931 0.172
NP_439937.1_4 Reverse -352 -371 22.1239 0.037
NP_439937.1_9 Reverse -294 -311 2.49641 0.0798
NP_439937.1_9 Forward -305 -288 -15.9897 0.287
NP_440408.1_7 Forward -361 -342 9.43923 0.259
NP_440439.1_1 Forward -307 -294 2.96921 0.122
NP_440439.1_1 Reverse -292 -305 1.29759 0.157
NP_440372.1_2 Forward -303 -296 16.3621 0.0124
NP_440372.1_2 Reverse -296 -303 16.3621 0.0124
NP_442488.1_7 Reverse -255 -274 12.2908 0.21
NP_439977.1_5 Forward -310 -291 11.2092 0.0715
NP_440139.1_1 Forward -310 -291 7.57013 0.129
NP_442384.1_10 Reverse -295 -308 18.5055 0.00446
NP_442384.1_10 Forward -304 -291 9.75405 0.0497
NP_442114.1_4 Reverse -295 -306 9.20345 0.17
NP_441018.1_7 Reverse -348 -367 18.1907 0.0587
NP_441018.1_7 Reverse -336 -355 7.37428 0.272
NP_442790.1_4 Reverse -286 -305 -2.55715 0.115
NP_442262.1_10 Forward -303 -296 14.1988 0.0123
NP_442262.1_10 Reverse -296 -303 14.1988 0.0123
NP_441689.1_5 Reverse -293 -303 5.87944 0.197
NP_440344.1_10 Forward -311 -294 3.0871 0.0274
NP_440344.1_10 Reverse -288 -305 -11.7609 0.227
NP_440282.1_3 Forward -366 -347 1.17943 0.281
NP_440531.1_6 Reverse -287 -306 13.5691 0.0415
NP_440531.1_6 Reverse -344 -363 -3.04881 0.26
NP_441965.1_10 Forward -307 -291 4.58176 0.237
NP_441965.1_10 Reverse -292 -308 2.12349 0.289
NP_440297.1_9 Reverse -296 -306 -0.118297 0.282
NP_440297.1_9 Forward -303 -293 -0.216628 0.282
NP_442280.1_10 Reverse -348 -366 5.06482 0.291
NP_441896.1_3 Reverse -286 -305 6.39097 0.102
NP_441896.1_3 Forward -313 -294 -2.75381 0.289
NP_442553.1_7 Forward -97 -83 16.3225 0.255
NP_440999.1_9 Forward -308 -294 2.5562 0.148
NP_440888.1_2 Reverse -295 -309 17.1085 0.00462
NP_440888.1_2 Forward -304 -290 16.9119 0.00511
NP_440179.1_6 Reverse -296 -315 5.11266 0.245
NP_440179.1_6 Forward -303 -284 4.81767 0.246
NP_442225.1_9 Forward -240 -221 10.4225 0.275
NP_442033.1_10 Forward -306 -287 3.04771 0.0873
NP_441949.1_5 Forward -131 -112 15.2111 0.146
NP_442818.1_3 Reverse -240 -257 -4.68105 0.249
NP_442807.1_1 Forward -396 -377 16.5191 0.0604
NP_441543.1_2 Reverse -296 -305 18.486 0.00236
NP_441543.1_2 Forward -303 -294 16.9127 0.00359
NP_442845.1_2 Reverse -289 -303 6.19444 0.215
NP_441178.1_6 Forward -55 -36 1.27698 0.285
NP_441469.1_8 Forward -305 -296 16.126 0.00797
NP_441469.1_8 Reverse -294 -303 6.48957 0.227
NP_441469.1_8 Forward -177 -168 5.11294 0.289
NP_443064.1_6 Forward -304 -294 12.5669 0.0796
NP_442578.1_7 Forward -303 -296 14.5921 0.026
NP_442578.1_7 Reverse -296 -303 14.5921 0.026
NP_441462.1_2 Forward -304 -294 11.5831 0.00406
NP_441462.1_2 Reverse -295 -305 11.5831 0.00406
NP_441621.1_7 Forward -306 -292 -3.24533 0.188
NP_441621.1_7 Reverse -293 -307 -3.24533 0.188
NP_443062.1_1 Reverse -295 -313 4.93815 0.244
NP_443062.1_6 Forward -312 -293 3.73603 0.229
NP_442204.1_5 Forward -186 -167 0.0977854 0.272
NP_441560.1_8 Reverse -290 -309 11.4153 0.299
NP_440544.1_5 Reverse -216 -223 14.5681 0.264
NP_440516.1_8 Forward -304 -295 16.9127 0.00442
NP_440516.1_8 Reverse -295 -304 16.9127 0.00442
NP_442428.1_5 Forward -303 -296 15.8704 0.0124
NP_442428.1_5 Reverse -296 -303 15.8704 0.0124
NP_440673.1_2 Reverse -285 -304 8.341 0.273
NP_440673.1_3 Forward -302 -295 12.4288 0.0426
NP_440673.1_3 Reverse -297 -304 12.4288 0.0426
NP_440673.1_7 Reverse -284 -303 2.16274 0.232
NP_441052.1_2 Forward -304 -294 19.9412 0.00106
NP_441052.1_2 Reverse -295 -305 10.5014 0.0285
NP_442219.1_9 Forward -303 -294 17.7976 0.00718
NP_442219.1_9 Reverse -296 -305 8.35786 0.0681
NP_440436.1_4 Reverse -296 -305 18.1905 0.00233
NP_440436.1_4 Forward -303 -294 17.2072 0.00233
NP_441884.1_9 Forward -307 -288 -14.1602 0.138
NP_440222.1_7 Reverse -341 -360 14.8474 0.213
NP_441719.1_4 Forward -303 -296 16.3621 0.0124
NP_441719.1_4 Reverse -296 -303 16.3621 0.0124
NP_441733.1_10 Reverse -292 -305 16.9322 0.0382
NP_442873.1_2 Reverse -222 -241 17.3048 0.178
NP_442206.1_10 Forward -176 -161 0.963207 0.241
NP_443054.1_2 Forward -306 -292 1.17956 0.251
NP_443054.1_2 Reverse -178 -192 -0.492064 0.295
NP_441966.1_7 Forward -365 -346 1.37531 0.208
NP_440864.1_9 Reverse -342 -361 0.687771 0.139
NP_441851.1_7 Forward -118 -99 8.75091 0.286
NP_441851.1_10 Forward -305 -295 16.008 0.00552
NP_441851.1_10 Reverse -294 -304 15.8113 0.00552
NP_441851.1_10 Reverse -173 -183 3.91327 0.296
NP_441668.1_4 Reverse -244 -263 3.44104 0.187
NP_442515.1_1 Forward -305 -291 13.8643 0.0278
NP_442515.1_1 Reverse -294 -308 4.62115 0.107
NP_441396.1_5 Forward -240 -231 9.4395 0.205
NP_441349.1_10 Forward -314 -295 -6.39206 0.228
NP_440432.1_9 Forward -303 -288 -1.39674 0.167
NP_442843.1_1 Reverse -237 -256 -11.5053 0.291
NP_439960.1_10 Reverse -160 -178 -4.40575 0.293
NP_440474.1_8 Reverse -296 -310 6.39049 0.227
NP_440588.1_2 Forward -313 -294 -3.3438 0.185
NP_440040.1_8 Reverse -130 -149 14.0846 0.134
NP_442006.1_2 Forward -197 -180 -15.7924 0.228
NP_443047.1_7 Forward -65 -46 4.03102 0.271
NP_441570.1_1 Forward -304 -286 -13.0589 0.221
NP_441078.1_4 Forward -304 -295 19.6659 0.0007
NP_441078.1_4 Reverse -295 -304 19.6659 0.0007
NP_442729.1_8 Reverse -291 -304 19.4888 0.0312
NP_442348.1_2 Forward -235 -226 7.76787 0.28
NP_442443.1_1 Forward -240 -221 -2.36049 0.256
NP_440526.1_3 Forward -303 -292 10.7762 0.0646
NP_440526.1_3 Reverse -181 -192 7.62965 0.139
NP_441432.1_8 Reverse -294 -303 16.8143 0.00595
NP_441432.1_8 Forward -305 -296 8.25953 0.0755
NP_441432.1_9 Reverse -205 -218 17.5184 0.0642
NP_442320.1_8 Forward -310 -296 -0.983719 0.0817
NP_442320.1_8 Reverse -289 -303 -2.55701 0.0913
NP_441732.1_2 Forward -308 -292 -15.3794 0.145
NP_442447.1_1 Reverse -246 -265 6.58763 0.258
NP_440497.1_2 Reverse -181 -200 3.44104 0.295
NP_440629.1_4 Reverse -233 -252 19.3707 0.0687
NP_440760.1_1 Forward -304 -285 -6.68705 0.0622
NP_441057.1_4 Reverse -179 -197 -1.65248 0.272
NP_442727.1_1 Reverse -160 -174 11.2093 0.297
NP_442489.1_7 Forward -304 -295 20.1576 0.000695
NP_442489.1_7 Reverse -295 -304 20.1576 0.000695
NP_442079.1_6 Forward -363 -344 12.7825 0.283
NP_442079.1_7 Forward -303 -284 1.76941 0.241
NP_442079.1_7 Reverse -296 -315 -0.000545616 0.287
NP_440559.1_1 Forward -303 -294 17.4043 0.00658
NP_440559.1_1 Reverse -296 -305 8.75118 0.0586
NP_441659.2_8 Forward -304 -294 18.1713 0.00133
NP_441659.2_8 Reverse -295 -305 11.9764 0.0147
NP_441659.2_8 Forward -176 -166 -0.0199663 0.282
NP_442913.1_10 Forward -191 -172 -5.31042 0.262
NP_442849.1_1 Forward -345 -331 8.25939 0.282
NP_442346.1_5 Reverse -294 -304 16.6963 0.00248
NP_442346.1_5 Forward -305 -295 9.02648 0.118
NP_442346.1_5 Forward -400 -390 8.33817 0.14
NP_442346.1_5 Reverse -389 -399 7.25653 0.176
NP_440545.1_3 Reverse -291 -308 -4.77938 0.232
NP_442311.1_5 Reverse -241 -260 1.17943 0.27
NP_442603.1_7 Forward -304 -290 17.4035 0.0221
NP_441888.1_7 Forward -309 -295 3.14618 0.225
NP_441948.1_4 Forward -311 -293 7.4923 0.0623
NP_441948.1_4 Reverse -288 -306 0.0191479 0.137
NP_441833.1_4 Forward -303 -296 15.9687 0.0124
NP_441833.1_4 Reverse -296 -303 15.9687 0.0124
NP_442162.1_9 Forward -303 -296 16.2637 0.0124
NP_442162.1_9 Reverse -296 -303 16.2637 0.0124
NP_442199.1_5 Forward -312 -293 5.01433 0.0977
NP_442140.1_3 Reverse -296 -306 14.238 0.0486
NP_442140.1_3 Forward -303 -293 13.5497 0.0542
NP_442021.1_3 Reverse -352 -371 -4.52377 0.251
NP_440875.1_9 Reverse -297 -307 8.46937 0.233
NP_441813.1_5 Forward -306 -296 19.4496 0.00647
NP_441813.1_5 Reverse -293 -303 8.73149 0.0367
NP_440594.1_8 Reverse -296 -309 12.9 0.152
NP_440594.1_8 Forward -303 -290 10.9334 0.153
NP_440590.1_4 Reverse -296 -309 12.3107 0.0148
NP_440590.1_4 Forward -303 -290 11.7207 0.0187
NP_440567.1_1 Reverse -296 -310 3.53951 0.141
NP_440567.1_1 Forward -303 -289 -0.590395 0.293
NP_442497.1_10 Forward -303 -294 10.4228 0.0087
NP_442497.1_10 Reverse -296 -305 10.4228 0.0087
NP_440821.1_4 Reverse -293 -303 17.9746 0.00497
NP_440821.1_4 Forward -306 -296 10.2065 0.0163
NP_441239.1_9 Forward -306 -294 14.1986 0.0288
NP_441239.1_9 Reverse -293 -305 9.67541 0.0987
NP_441727.1_3 Reverse -351 -370 5.50599 0.252
NP_441892.1_1 Reverse -286 -303 -2.61609 0.224
NP_441017.1_6 Reverse -176 -190 15.9285 0.0851
NP_440833.1_6 Forward -256 -242 7.57046 0.278
NP_440354.1_7 Reverse -289 -307 12.9005 0.206
NP_441782.1_5 Reverse -287 -306 6.4893 0.289
NP_440546.1_4 Reverse -295 -305 11.8882 0.0679
NP_440546.1_4 Forward -304 -294 10.046 0.109
NP_440462.1_4 Reverse -160 -174 11.3077 0.21
NP_440462.1_6 Forward -306 -296 17.2863 0.00752
NP_440462.1_6 Reverse -293 -303 10.3048 0.0396
NP_440868.1_4 Forward -308 -296 10.5604 0.0364
NP_440868.1_4 Reverse -291 -303 9.38042 0.049
NP_440401.1_9 Reverse -229 -236 12.6251 0.287
NP_441497.1_4 Forward -140 -123 18.5251 0.23
NP_442787.1_9 Forward -46 -27 12.0942 0.296
NP_442479.1_8 Reverse -1 -20 2.94938 0.259
NP_441848.1_7 Forward -255 -236 7.76679 0.196
NP_440696.1_3 Reverse -348 -366 1.49411 0.217
NP_442039.1_4 Forward -303 -296 15.1821 0.0124
NP_442039.1_4 Reverse -296 -303 15.1821 0.0124
NP_442039.1_10 Reverse -215 -233 10.0481 0.293
NP_441811.1_8 Reverse -289 -303 14.1593 0.175
NP_441811.1_8 Reverse -168 -182 8.75105 0.231
NP_442786.1_2 Forward -137 -118 17.2359 0.0875
NP_442837.1_3 Forward -303 -296 15.7721 0.0124
NP_442837.1_3 Reverse -296 -303 15.7721 0.0124
NP_442053.1_1 Forward -304 -295 18.3876 0.0007
NP_442053.1_1 Reverse -295 -304 18.3876 0.0007
NP_440505.1_3 Reverse -293 -303 16.598 0.00683
NP_440505.1_3 Forward -306 -296 15.9097 0.00857
NP_441252.1_6 Reverse -251 -258 14.3954 0.168
NP_440914.1_1 Forward -304 -294 17.5935 0.000537
NP_440914.1_1 Reverse -295 -305 8.6151 0.186
NP_441011.1_8 Reverse -296 -305 16.9127 0.00602
NP_441011.1_8 Forward -303 -294 8.25953 0.144
NP_442533.1_6 Forward -304 -295 17.2076 0.00137
NP_442533.1_6 Reverse -295 -304 17.2076 0.00137
NP_442533.1_6 Forward -399 -390 2.16301 0.27
NP_442541.1_10 Reverse -188 -202 0.687325 0.3
NP_442232.1_3 Reverse -287 -306 -13.8652 0.283
NP_443016.1_10 Reverse -349 -368 12.7825 0.19
NP_441482.1_7 Reverse -289 -303 -10.6202 0.211
NP_441482.1_7 Reverse -85 -99 -11.3085 0.254
NP_441482.1_7 Forward -361 -347 -11.5051 0.268
NP_441482.1_7 Forward -310 -296 -12.2918 0.292
NP_439944.1_9 Forward -303 -293 19.1546 0.00329
NP_441697.1_5 Reverse -63 -82 -9.02441 0.268
NP_441697.1_5 Forward -294 -275 -11.6982 0.298
NP_441028.1_6 Reverse -215 -225 12.0743 0.192
NP_441028.1_6 Forward -321 -311 12.0743 0.192
NP_440116.1_8 Reverse -296 -315 -7.17871 0.223
NP_441527.1_4 Reverse -2 -21 -8.45146 0.244
NP_441527.1_4 Reverse -132 -151 -10.4568 0.27
NP_441527.1_4 Forward -219 -200 -12.1756 0.285
NP_440115.1_6 Reverse -292 -302 9.7148 0.115
NP_439965.1_7 Reverse -282 -301 11.293 0.294
NP_441544.1_1 Reverse -349 -361 14.3953 0.282
NP_441602.1_3 Reverse -347 -366 -0.688862 0.224
NP_441106.1_1 Forward -305 -296 18.191 0.0028
NP_441106.1_1 Reverse -294 -303 9.63616 0.0311
NP_442306.1_10 Forward -309 -290 -10.522 0.11
NP_442306.1_10 Reverse -290 -309 -20.2567 0.202
NP_441186.1_4 Reverse -150 -160 14.9258 0.274
NP_441286.1_1 Forward -305 -293 12.1337 0.0104
NP_441286.1_1 Reverse -294 -306 6.03717 0.0258
NP_441286.1_1 Reverse -179 -191 0.825626 0.107
NP_442674.1_2 Forward -258 -239 16.6174 0.155
NP_442674.1_2 Reverse -273 -292 10.0292 0.208
NP_440670.1_8 Forward -304 -295 18.3876 0.000699
NP_440670.1_8 Reverse -295 -304 18.3876 0.000699
NP_440670.1_8 Forward -189 -180 10.9145 0.0386
NP_441886.1_2 Reverse -159 -178 14.9458 0.0968
NP_440886.1_7 Forward -305 -295 17.7774 0.0011
NP_440886.1_7 Reverse -294 -304 7.94438 0.0805
NP_440886.1_7 Forward -177 -167 4.60114 0.227
NP_442614.1_2 Forward -304 -290 8.45605 0.255
NP_442072.1_9 Reverse -294 -312 -22.007 0.216
NP_440907.2_8 Forward -303 -293 10.8943 0.0969
NP_440907.2_8 Reverse -296 -306 7.94438 0.117
NP_441021.1_1 Reverse -335 -354 -8.65367 0.199
NP_442459.1_7 Forward -123 -104 -0.000545616 0.272
NP_441463.1_2 Forward -160 -142 6.61779 0.143
NP_441463.1_3 Forward -314 -295 0.196116 0.132
NP_442842.1_4 Forward -123 -104 2.45773 0.265
NP_441626.1_2 Forward -303 -296 15.7721 0.0124
NP_441626.1_2 Reverse -296 -303 15.7721 0.0124
NP_442615.1_1 Forward -313 -295 13.6872 0.0112
NP_442615.1_1 Reverse -286 -304 -6.27403 0.241
NP_441962.1_4 Forward -309 -290 -12.5869 0.26
NP_440387.1_1 Forward -304 -288 3.79511 0.0519
NP_440855.1_1 Forward -179 -160 6.09597 0.147
NP_441431.1_2 Forward -307 -293 7.47213 0.241
NP_441431.1_3 Reverse -161 -180 4.71934 0.263
NP_441836.1_1 Forward -315 -296 15.2979 0.149
NP_441836.1_2 Forward -310 -291 20.4523 0.0193
NP_441993.1_1 Reverse -352 -371 5.06532 0.208
NP_442224.1_1 Forward -178 -159 -2.85214 0.233
NP_441174.1_1 Reverse -29 -44 13.3529 0.231
NP_440114.1_10 Reverse -295 -309 9.14437 0.183
NP_442324.1_7 Reverse -234 -253 9.4257 0.268
NP_440293.1_9 Forward -99 -85 13.9534 0.209
NP_440766.1_4 Forward -187 -173 0.491246 0.28
NP_439988.1_3 Forward -187 -173 3.73617 0.298
NP_441237.1_2 Forward -250 -231 14.1591 0.238
NP_441237.1_9 Forward -303 -293 14.9263 0.0242
NP_439910.1_2 Forward -312 -295 -12.4492 0.0863
NP_442867.1_8 Reverse -344 -363 5.60432 0.276
NP_440457.1_1 Forward -308 -296 8.88877 0.101
NP_440987.1_6 Forward -155 -136 9.95922 0.268
NP_441984.1_3 Forward -371 -353 6.214 0.273
NP_442509.1_9 Reverse -295 -305 16.2041 0.00739
NP_442509.1_9 Forward -304 -294 8.14104 0.192
NP_442509.1_9 Reverse -225 -235 6.27276 0.279
NP_442509.1_9 Forward -183 -173 5.97777 0.298
NP_442439.1_3 Forward -376 -357 5.70265 0.298
NP_442514.1_5 Forward -100 -81 -8.85106 0.29
NP_440554.1_4 Reverse -296 -306 16.4996 0.0189
NP_440554.1_4 Forward -303 -293 6.37155 0.123
NP_441885.1_3 Forward -148 -129 18.7159 0.0917
NP_441885.1_4 Forward -271 -252 21.2389 0.053
NP_441885.1_5 Forward -304 -294 20.9245 0.000538
NP_441885.1_5 Reverse -295 -305 11.4848 0.00668
NP_440628.1_1 Reverse -309 -319 14.6456 0.248
NP_440478.1_3 Reverse -285 -304 16.6165 0.244
NP_440478.1_9 Forward -179 -160 12.0942 0.255
NP_440478.1_10 Forward -306 -292 6.58777 0.288
NP_442341.1_7 Forward -305 -291 15.9292 0.0197
NP_442341.1_7 Reverse -294 -308 2.45787 0.256
NP_440409.1_1 Reverse -287 -306 -0.688862 0.218
NP_440423.1_6 Reverse -287 -306 -14.3569 0.224
NP_443000.1_7 Forward -306 -296 11.5831 0.0344
NP_443000.1_7 Reverse -293 -303 10.4031 0.0345
NP_441842.1_1 Reverse -297 -310 10.3434 0.3
NP_440275.1_3 Reverse -293 -303 17.6796 0.0102
NP_440275.1_3 Forward -306 -296 15.418 0.0178
NP_440275.1_3 Forward -191 -181 4.3066 0.199
NP_440091.1_1 Forward -308 -296 3.2839 0.163
NP_440091.1_1 Reverse -291 -303 1.41561 0.197
NP_442451.1_2 Reverse -172 -191 -4.13045 0.202
NP_441635.1_1 Reverse -136 -155 7.78217 0.236
NP_439962.1_4 Forward -178 -159 -8.752 0.298
NP_440175.1_7 Reverse -342 -360 17.5608 0.0886
NP_440149.1_8 Forward -304 -285 8.55425 0.0598
NP_440149.1_8 Reverse -346 -365 -7.27704 0.278
NP_441105.1_3 Forward -187 -168 -5.21209 0.214
NP_440216.1_1 Reverse -295 -309 16.5192 0.00277
NP_440216.1_1 Forward -304 -290 -10.6202 0.145
NP_440216.1_9 Forward -359 -350 5.89959 0.289
NP_440172.1_1 Forward -304 -294 15.0247 0.00945
NP_440172.1_1 Reverse -295 -305 8.73149 0.0586
NP_442788.1_1 Reverse -198 -217 9.73422 0.249
NP_442015.1_10 Reverse -163 -176 7.88576 0.0755
NP_442015.1_10 Reverse -176 -189 6.4108 0.116
NP_442015.1_10 Forward -308 -295 3.06754 0.185
NP_442015.1_10 Forward -187 -174 0.0192843 0.245
NP_441226.1_7 Forward -303 -296 14.4934 0.0123
NP_441226.1_7 Reverse -296 -303 14.4934 0.0123
NP_440305.1_1 Forward -219 -205 16.9137 0.133
NP_441111.1_7 Forward -303 -295 18.7023 0.00294
NP_441111.1_7 Reverse -296 -304 18.7023 0.00294
NP_441766.1_2 Forward -304 -295 17.5026 0.00297
NP_441766.1_2 Reverse -295 -304 17.5026 0.00297
NP_440416.1_9 Forward -54 -35 -15.7335 0.198
NP_440416.1_9 Forward -178 -159 -21.4367 0.294
NP_442116.1_6 Forward -274 -257 7.30953 0.259
NP_442403.1_8 Forward -239 -220 -1.47551 0.258
NP_442154.1_1 Reverse -159 -177 -12.0756 0.217
NP_442154.1_1 Reverse -344 -362 -15.4188 0.218
NP_440261.1_5 Forward -303 -290 6.60746 0.0318
NP_440261.1_5 Reverse -296 -309 -4.50394 0.151
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGCCATGACTTTAATGCTCCTATAAGTTCTGAACCCACAGCCAAAGCAAGCACAGGGGCTAACAAAAGTTTAATGCCACTTTCCTCTATTTGTCCGGCGATCGCCACAAATGGTCACAATTTATCAATTCCTTGGACTTCTTTGCCCAAATTTGCCAACTTGCTGGGGGTTTTTACGGAGAAAAAATGGACTGAAGACAACTGGCACAGGGACGATTGGAATCGGCCACCCCAAAGGTGGGTTTTGTAAACTTATTTGTTACTTTGTTAAGGTAAAGCAATATTACTGGGCTTTTCTAGGTCACTTGGCCTGGCTAAAACTAAATTCTAAGGCTGGTATTGACTTTCCTTCCTGTCCTAGCCCGCTAATTCGGTACTATTCTTCCCTCGCATCGTTTTT

CDS

ATGAACAAGTACATCCCCCACCAACGTCTGCGACGGCAACTTTCCCTGCTAGGTTTATTAAGTTTTTCCCTGATGGGTTGCAGCGATCTCTGGGAACAAAATGTCAAAGCCCAAACGGAGAATACTGAATCAAACCAGGCGATCGCCGTGGATGTGGCCCTAGCTCGACCCCAAGCATTGACCAAGGAGTTGGAATATACGGGCACCACAGCCCCAGTGCGGGAAGCCTCCATCAAAGCCCAGATTGAAGGACGACTGCAAAGGCTACCAGTGGATGTGGGCGATCGGGTCAGGGGAGAAGAAATATTGGCGGAAATTGAAGATGATTTATTACTGGGGGCGGTAGACCAGGCCAAAGCGGAGAAAATGGCCCAACGTTCGGAAGTTTTAACTGCCCAAAGTCAGGTGGGGGATGCCCAAATTCGGGTAGAACAGGCCCGTTTGCAACTGCAACAGGCCCAGGCGGACATTATCCGTTTGGAAACTTCCCTCAACGCCCGCATTGAACAAGCCCGGCTGGAAGTAGATCAAACCCAGGCCGATGCTGCTCGCTTCCGACTATTAGCCGAAGAGGGAGCTGGCGGTGCCCAACAGGCGGAACAGGCAGAAACCAGAGCCCGTCAAGCCAAGGAAATTTTGCGTAACGAACAGGCCAGCGCTAGCCAACAATTAAGCCAAGCTAAAACAGCGGCCAAAACTGCGTCCCAAATCCTCAACTCGGCGATCGCCCAGGTGCAGATCGAACAGCAGAGGGTGGGGGCGGCCACCGCCCAGATGAATGCCCAGCGAGCTTCCATTGAACAGGCCCAAACTAGGCAACAGTACGCCACCGTCAGAGCACCATTTCCGGGGCGGGTGTTACGACGATTAAGTGAACCAGGCAATTTAGTGCAGCCGGGGACGGAAATTTTGCAACTGGGGGATTTTCGTCAGTTAGAAATTGACGTGCAGGTATCGGAGTTGCAACTGGCCCAAATTGCCCTACAGCAAAAGGTCAACGTCAAGCTAGATGCGTTTCCTGGCCAGACTTTTACGGGCGTGGTAACCCGCATTTCCCCCCAGGCTGACGTTAATTCTCGCCTTGTGCCGGTGGAAATAACCATGGATAATCCTGGTGAAAAAATTGGCGCTGGGCTGTTGGCCAGGGTCAGTTTTGATGCCAGTGCAGATACCAATGTGGTAGTTCCAGAATCTGCCATTGTCGATGAAGATGCCATTTTTGTGGTGACCAAAGCAGGGGAAAAAGACGTGCTGGAACGGCGATCGGTTACCCTGGGGCAAACTGCCAACGGGAAGGTGGAAATTGTGGCAGGCTTAGCTCCCCAGGAACGTTTTGTGGTCCGCAGTAGTAGACCGCTACAACCGGATAGTCAAATTCGTCTCAGCGTTTTATCAGAAAAATAG

Protein

MNKYIPHQRLRRQLSLLGLLSFSLMGCSDLWEQNVKAQTENTESNQAIAVDVALARPQALTKELEYTGTTAPVREASIKAQIEGRLQRLPVDVGDRVRGEEILAEIEDDLLLGAVDQAKAEKMAQRSEVLTAQSQVGDAQIRVEQARLQLQQAQADIIRLETSLNARIEQARLEVDQTQADAARFRLLAEEGAGGAQQAEQAETRARQAKEILRNEQASASQQLSQAKTAAKTASQILNSAIAQVQIEQQRVGAATAQMNAQRASIEQAQTRQQYATVRAPFPGRVLRRLSEPGNLVQPGTEILQLGDFRQLEIDVQVSELQLAQIALQQKVNVKLDAFPGQTFTGVVTRISPQADVNSRLVPVEITMDNPGEKIGAGLLARVSFDASADTNVVVPESAIVDEDAIFVVTKAGEKDVLERRSVTLGQTANGKVEIVAGLAPQERFVVRSSRPLQPDSQIRLSVLSEK