Your browser is old and dusty. Try Google Chrome!

Details for sll0136

ORF sll0136
Accession NP_441891.1
Symbol
Category Degradation of proteins, peptides, and glycopeptides
Definition aminopeptidase P
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -285 -299 -1.67204 0.269
NP_441061.1_2 Forward -361 -347 -2.26202 0.287
NP_441418.1_6 Forward -299 -280 -29.4998 0.228
NP_441818.1_1 Reverse -279 -290 9.49793 0.241
NP_441818.1_9 Reverse -304 -323 -9.93197 0.291
NP_442752.1_4 Forward -245 -238 10.5605 0.1
NP_442062.1_8 Reverse -250 -260 6.8632 0.116
NP_441859.1_4 Forward -239 -220 13.5691 0.213
NP_440304.1_4 Reverse -357 -367 4.50326 0.261
NP_441781.1_7 Forward -34 -15 -2.16383 0.288
NP_441035.1_3 Forward -263 -244 2.3594 0.227
NP_442602.1_3 Reverse -350 -369 -3.63879 0.287
NP_441620.1_3 Forward -294 -275 11.0125 0.297
NP_441352.1_2 Forward -294 -275 5.211 0.205
NP_441935.1_1 Forward -224 -205 11.6025 0.208
NP_441208.1_1 Reverse -132 -151 -5.99873 0.287
NP_441594.1_6 Forward -377 -358 4.81767 0.211
NP_441925.1_4 Forward -96 -77 -16.2258 0.281
NP_440273.1_3 Reverse -89 -108 9.43923 0.19
NP_440856.1_7 Reverse -313 -332 -8.94866 0.28
NP_441083.1_5 Reverse -271 -281 3.81494 0.164
NP_441738.1_2 Forward -212 -205 6.52862 0.261
NP_441716.1_1 Forward -347 -333 11.5043 0.0936
NP_441327.1_5 Reverse -113 -122 12.6844 0.298
NP_440747.1_10 Forward -344 -332 -12.2524 0.254
NP_441486.1_1 Forward -290 -276 -4.91696 0.213
NP_442330.1_4 Reverse -138 -157 13.775 0.286
NP_442634.1_4 Forward -216 -202 -3.24533 0.161
NP_440842.1_10 Reverse -105 -119 1.08123 0.296
NP_441014.1_5 Reverse -299 -317 9.16393 0.286
NP_441014.1_8 Forward -97 -78 -2.65548 0.236
NP_442848.1_4 Forward -118 -104 8.16106 0.282
NP_440376.1_1 Reverse -206 -215 2.06468 0.236
NP_440376.1_1 Reverse -386 -395 1.76968 0.242
NP_440376.1_1 Reverse -205 -214 -0.000272808 0.285
NP_441002.1_4 Reverse -111 -130 13.5691 0.291
NP_442687.1_7 Reverse -1 -11 11.4848 0.0994
NP_441846.1_10 Reverse -78 -97 -21.3384 0.256
NP_441846.1_10 Reverse -77 -96 -22.3217 0.259
NP_440642.1_1 Forward -347 -328 8.84924 0.239
NP_440642.1_10 Forward -23 -9 3.73557 0.265
NP_440141.1_4 Reverse -301 -320 -5.11376 0.296
NP_441487.1_9 Reverse -136 -155 4.62101 0.142
NP_442300.1_1 Reverse -188 -207 7.57094 0.229
NP_442937.1_5 Forward -352 -333 6.58763 0.275
NP_440203.1_5 Forward -197 -187 11.091 0.205
NP_440203.1_5 Forward -365 -355 9.71433 0.245
NP_442911.1_2 Forward -178 -159 -11.0136 0.296
NP_442064.1_4 Forward -21 -2 4.71854 0.285
NP_443055.1_6 Reverse -345 -363 6.50823 0.167
NP_443055.1_6 Forward -327 -309 0.510066 0.242
NP_443055.1_6 Reverse -359 -377 -1.16155 0.273
NP_440496.1_1 Reverse -338 -357 7.47261 0.245
NP_440138.1_1 Forward -200 -182 6.1149 0.27
NP_443044.1_1 Reverse -17 -36 13.1758 0.212
NP_441294.1_7 Reverse -274 -288 11.8423 0.124
NP_442771.1_1 Forward -105 -87 6.214 0.0626
NP_440147.1_4 Reverse -357 -370 5.62415 0.119
NP_441175.1_2 Forward -356 -337 14.8474 0.175
NP_440206.1_4 Forward -357 -338 -1.67294 0.292
NP_441041.1_7 Forward -371 -359 11.0132 0.0864
NP_442996.1_1 Reverse -110 -129 4.43995 0.267
NP_441547.1_2 Forward -352 -334 4.05072 0.26
NP_442941.1_3 Reverse -237 -247 4.69992 0.14
NP_440983.1_5 Reverse -332 -351 -2.16383 0.231
NP_440983.1_5 Reverse -102 -121 -5.9004 0.273
NP_442575.1_8 Reverse -6 -25 -2.36049 0.242
NP_442575.1_8 Forward -306 -287 -2.65548 0.242
NP_001035871.2_7 Reverse -203 -213 13.2547 0.219
NP_441087.1_6 Forward -98 -80 -1.75153 0.27
NP_440723.1_10 Forward -112 -93 20.3597 0.177
NP_441556.1_10 Forward -220 -206 11.7792 0.214
NP_441644.1_6 Forward -395 -385 3.32285 0.288
NP_442215.1_2 Forward -262 -246 -0.0397962 0.159
NP_442215.1_2 Reverse -269 -285 -2.5964 0.201
NP_442142.1_4 Reverse -335 -348 13.785 0.0334
NP_442142.1_4 Forward -316 -303 7.68852 0.132
NP_442142.1_4 Reverse -281 -294 3.65697 0.248
NP_443009.1_5 Reverse -358 -369 5.26972 0.21
NP_443009.1_5 Forward -215 -204 3.69644 0.282
NP_440379.1_5 Reverse -212 -231 -3.44213 0.204
NP_440379.1_5 Forward -263 -244 -8.752 0.254
NP_441015.1_10 Forward -298 -279 -8.35868 0.273
NP_441015.1_10 Reverse -78 -97 -8.65367 0.276
NP_442253.1_5 Forward -371 -354 0.137172 0.203
NP_441826.1_2 Reverse -278 -292 -0.983719 0.23
NP_441826.1_5 Forward -305 -286 0.884433 0.298
NP_441330.1_1 Forward -250 -231 -13.1769 0.183
NP_441764.1_8 Reverse -112 -122 13.8947 0.284
NP_442868.1_6 Forward -216 -206 2.53664 0.205
NP_442808.1_1 Reverse -235 -245 5.48612 0.151
NP_442808.1_1 Forward -216 -206 2.73286 0.256
NP_442113.1_10 Forward -366 -347 -1.86883 0.205
NP_442342.1_9 Forward -217 -201 2.71347 0.283
NP_441114.1_3 Forward -198 -189 17.1093 0.113
NP_441114.1_3 Forward -258 -249 8.25953 0.231
NP_440558.1_2 Forward -371 -352 -0.295539 0.2
NP_440558.1_2 Forward -218 -199 -2.36049 0.226
NP_440558.1_2 Reverse -377 -396 -6.78538 0.28
NP_441518.1_3 Reverse -343 -362 -4.32711 0.12
NP_441878.1_6 Reverse -250 -260 -6.60814 0.193
NP_441878.1_6 Reverse -190 -200 -7.49312 0.231
NP_441878.1_6 Forward -260 -250 -7.59145 0.245
NP_441445.1_1 Forward -296 -277 15.2408 0.0453
NP_441445.1_8 Forward -160 -141 -5.70374 0.277
NP_441433.1_8 Forward -47 -28 5.211 0.178
NP_442777.1_1 Forward -97 -78 7.07848 0.253
NP_442830.1_5 Forward -216 -202 2.06395 0.277
NP_441574.1_1 Forward -299 -280 -0.885524 0.211
NP_442645.1_2 Forward -295 -276 -21.1417 0.29
NP_442594.1_8 Reverse -78 -97 7.07928 0.215
NP_442594.1_8 Forward -295 -276 4.52268 0.26
NP_442590.1_10 Forward -221 -202 13.9625 0.126
NP_440299.1_1 Reverse -286 -299 2.67367 0.279
NP_441799.1_1 Reverse -274 -288 4.71887 0.238
NP_442528.1_10 Reverse -181 -200 16.7157 0.197
NP_441090.1_6 Reverse -81 -95 9.04604 0.261
NP_441559.1_8 Reverse -201 -215 1.47456 0.155
NP_441559.1_8 Reverse -354 -368 -6.29359 0.276
NP_441559.1_8 Forward -219 -205 -6.39192 0.277
NP_440748.1_5 Forward -311 -292 -0.787193 0.26
NP_441494.1_6 Reverse -354 -367 7.49244 0.259
NP_442993.1_1 Reverse -359 -375 -9.47957 0.186
NP_440570.1_5 Forward -357 -338 -2.16383 0.277
NP_440768.1_2 Forward -102 -83 10.2259 0.104
NP_442240.1_1 Forward -99 -80 3.04693 0.295
NP_442714.1_7 Forward -199 -180 -1.37718 0.287
NP_440586.1_1 Forward -303 -284 -2.85214 0.259
NP_440027.1_3 Forward -225 -207 1.88669 0.295
NP_439937.1_8 Reverse -339 -358 -2.85214 0.262
NP_439937.1_9 Reverse -283 -300 -14.6131 0.287
NP_441595.1_5 Reverse -152 -170 3.95239 0.295
NP_440408.1_10 Reverse -353 -372 10.4225 0.176
NP_441789.1_7 Forward -96 -77 -5.50783 0.298
NP_440819.1_5 Reverse -49 -57 7.68924 0.266
NP_442488.1_7 Forward -370 -351 8.65258 0.284
NP_441018.1_7 Reverse -318 -337 8.65258 0.241
NP_441689.1_5 Reverse -203 -213 5.48612 0.251
NP_442244.1_6 Forward -173 -154 10.7175 0.225
NP_440531.1_6 Forward -208 -189 -1.96717 0.241
NP_440562.1_10 Reverse -269 -287 12.9988 0.206
NP_440562.1_10 Forward -322 -304 6.214 0.284
NP_440999.1_9 Reverse -321 -335 1.17956 0.169
NP_439969.1_1 Forward -363 -344 9.93088 0.171
NP_441917.1_2 Reverse -301 -319 8.47561 0.28
NP_442845.1_2 Reverse -81 -95 3.34284 0.294
NP_441918.1_7 Reverse -250 -269 3.6377 0.265
NP_443064.1_6 Reverse -236 -246 10.3369 0.16
NP_442337.1_6 Forward -348 -329 15.8871 0.184
NP_442578.1_7 Forward -262 -255 9.97054 0.112
NP_441621.1_7 Reverse -342 -356 -6.39192 0.29
NP_443062.1_1 Reverse -254 -272 4.84065 0.247
NP_441410.1_3 Reverse -85 -104 7.37428 0.229
NP_442204.1_1 Forward -345 -334 1.33697 0.274
NP_440516.1_6 Forward -353 -339 8.55376 0.246
NP_440516.1_6 Reverse -284 -298 7.76712 0.268
NP_441443.1_7 Reverse -341 -360 2.3594 0.218
NP_440618.1_1 Reverse -139 -158 -11.5053 0.297
NP_442120.1_10 Forward -374 -355 3.24438 0.142
NP_442120.1_10 Reverse -353 -372 -13.6686 0.288
NP_442823.1_8 Reverse -1 -20 10.9142 0.297
NP_440673.1_3 Forward -198 -191 8.98723 0.203
NP_441052.1_2 Forward -313 -303 0.963343 0.255
NP_442219.1_8 Forward -297 -278 11.1627 0.188
NP_441004.1_1 Forward -299 -280 -12.1936 0.245
NP_441004.1_1 Forward -347 -328 -13.9635 0.263
NP_442366.1_10 Forward -219 -207 19.6068 0.113
NP_440129.1_10 Reverse -337 -351 5.70279 0.185
NP_442206.1_10 Forward -214 -199 0.766545 0.245
NP_443054.1_2 Reverse -357 -371 2.35953 0.245
NP_443054.1_2 Reverse -204 -218 1.37622 0.247
NP_443054.1_2 Reverse -23 -37 -0.197071 0.288
NP_441668.1_4 Reverse -143 -162 3.14605 0.187
NP_442515.1_1 Forward -322 -308 -0.295402 0.217
NP_441683.1_5 Reverse -211 -230 22.8122 0.0556
NP_440463.1_8 Forward -354 -335 8.85527 0.252
NP_440389.1_3 Forward -227 -208 13.6675 0.232
NP_440432.1_9 Reverse -237 -252 2.04485 0.128
NP_440432.1_9 Forward -361 -346 -2.08505 0.167
NP_439960.1_10 Forward -348 -330 -4.30741 0.293
NP_441477.1_10 Reverse -297 -315 3.26407 0.226
NP_440588.1_3 Forward -397 -378 13.9625 0.237
NP_442006.1_2 Reverse -182 -199 -7.72931 0.182
NP_442006.1_2 Forward -308 -291 -13.6292 0.197
NP_442006.1_2 Reverse -344 -361 -14.3175 0.203
NP_442006.1_2 Forward -389 -372 -15.8908 0.23
NP_442006.1_2 Reverse -80 -97 -16.4808 0.254
NP_442006.1_2 Reverse -81 -98 -17.8574 0.283
NP_442006.1_2 Reverse -338 -355 -18.939 0.296
NP_441570.1_1 Reverse -254 -272 -13.3539 0.222
NP_442729.1_5 Forward -348 -338 8.33817 0.248
NP_442729.1_5 Reverse -343 -353 8.1415 0.248
NP_440526.1_3 Forward -361 -350 1.04151 0.267
NP_441432.1_3 Reverse -97 -116 14.6499 0.275
NP_441432.1_8 Reverse -205 -214 2.55633 0.298
NP_441432.1_9 Forward -124 -111 10.2466 0.254
NP_443024.1_2 Forward -90 -77 16.7349 0.167
NP_441732.1_2 Reverse -355 -371 -16.6577 0.186
NP_442797.1_6 Reverse -223 -242 11.6185 0.238
NP_442797.1_6 Reverse -280 -299 7.06155 0.294
NP_442274.1_8 Reverse -283 -301 14.4287 0.286
NP_441945.1_10 Forward -300 -281 10.7175 0.247
NP_440913.1_3 Reverse -338 -351 16.3422 0.208
NP_442489.1_7 Forward -368 -359 -1.86856 0.259
NP_442489.1_7 Reverse -359 -368 -1.96689 0.28
NP_442763.1_8 Reverse -378 -397 1.37609 0.283
NP_442913.1_9 Reverse -230 -249 11.7992 0.199
NP_442346.1_5 Reverse -303 -313 8.92815 0.121
NP_442346.1_5 Reverse -190 -200 4.79825 0.272
NP_440545.1_3 Reverse -155 -172 4.07041 0.0751
NP_440545.1_3 Forward -172 -155 -2.02611 0.179
NP_440486.1_6 Reverse -331 -350 11.6025 0.207
NP_440459.1_2 Forward -202 -185 7.217 0.299
NP_440010.1_10 Forward -94 -75 1.67108 0.295
NP_442551.1_4 Reverse -248 -263 0.766545 0.245
NP_442551.1_4 Forward -202 -187 -0.80675 0.245
NP_440847.1_3 Reverse -286 -300 12.8803 0.232
NP_441050.1_5 Reverse -187 -205 4.05072 0.194
NP_440671.1_4 Forward -293 -279 13.2743 0.0864
NP_442723.1_1 Forward -106 -87 10.9134 0.238
NP_441227.1_7 Reverse -206 -225 15.4927 0.212
NP_441951.1_9 Reverse -372 -391 4.03102 0.254
NP_442193.1_1 Reverse -144 -162 15.1621 0.187
NP_442270.1_9 Forward -345 -326 -12.2919 0.292
NP_442772.1_4 Reverse -97 -116 -3.54046 0.244
NP_441874.1_1 Reverse -84 -98 18.1908 0.165
NP_442216.1_4 Forward -165 -157 8.08217 0.255
NP_442216.1_4 Reverse -27 -35 8.08217 0.255
NP_440354.1_7 Forward -206 -188 10.1472 0.224
NP_441782.1_5 Forward -208 -189 9.14423 0.256
NP_441230.1_5 Forward -373 -354 1.86774 0.232
NP_442611.1_5 Reverse -305 -319 18.8791 0.182
NP_441497.1_9 Reverse -231 -250 19.5673 0.108
NP_441474.1_1 Forward -97 -78 -2.95123 0.29
NP_440402.1_3 Forward -268 -249 5.50599 0.276
NP_439942.1_7 Reverse -144 -163 -4.6221 0.248
NP_442039.1_7 Forward -222 -212 11.6814 0.257
NP_442456.1_5 Reverse -83 -101 9.65558 0.26
NP_441252.1_6 Forward -112 -105 14.3954 0.168
NP_440914.1_1 Reverse -278 -288 10.5669 0.132
NP_440914.1_1 Reverse -236 -246 6.17532 0.293
NP_442101.1_10 Reverse -296 -315 -4.6221 0.144
NP_442533.1_1 Reverse -78 -97 2.94938 0.0967
NP_442533.1_6 Forward -313 -304 4.42462 0.179
NP_442533.1_6 Forward -214 -205 2.94966 0.232
NP_442533.1_6 Reverse -332 -341 2.65466 0.246
NP_442533.1_6 Forward -395 -386 1.37636 0.3
NP_442202.1_6 Forward -279 -260 1.67108 0.265
NP_442664.1_3 Reverse -373 -387 10.816 0.274
NP_440480.1_3 Reverse -224 -243 27.1388 0.00409
NP_441869.1_2 Forward -207 -188 10.1275 0.264
NP_442588.1_6 Forward -338 -319 1.57275 0.236
NP_442306.1_10 Reverse -354 -373 -20.2567 0.202
NP_441930.1_2 Reverse -250 -260 14.9263 0.19
NP_441930.1_2 Forward -34 -24 14.238 0.226
NP_440886.1_4 Forward -261 -242 12.8808 0.294
NP_440886.1_7 Forward -141 -131 4.99446 0.205
NP_440828.1_4 Forward -363 -344 -7.86776 0.294
NP_440083.1_6 Forward -153 -134 13.7649 0.296
NP_441808.1_8 Reverse -344 -363 7.96426 0.273
NP_442264.1_2 Forward -303 -286 6.03703 0.267
NP_441021.1_1 Reverse -360 -379 -6.39206 0.18
NP_441463.1_3 Forward -297 -278 -7.86702 0.262
NP_441463.1_6 Reverse -204 -218 8.54187 0.25
NP_441993.1_1 Reverse -353 -372 2.33652 0.26
NP_441993.1_1 Reverse -298 -317 2.04414 0.265
NP_441993.1_1 Forward -293 -274 0.582284 0.297
NP_440114.1_10 Reverse -205 -219 6.6861 0.26
NP_441500.1_6 Forward -115 -97 23.2253 0.0613
NP_440293.1_3 Reverse -351 -370 -4.03212 0.257
NP_440293.1_3 Reverse -302 -321 -6.29373 0.288
NP_440422.1_10 Reverse -261 -280 4.30507 0.293
NP_441237.1_9 Forward -199 -189 11.2881 0.189
NP_442867.1_8 Forward -360 -341 7.7676 0.242
NP_442867.1_8 Reverse -340 -359 5.11266 0.277
NP_441801.1_4 Forward -164 -154 12.8614 0.155
NP_442680.1_5 Forward -49 -30 3.78447 0.227
NP_440942.1_3 Reverse -299 -318 1.86774 0.298
NP_441253.1_1 Forward -158 -139 8.06259 0.205
NP_442514.1_5 Reverse -379 -398 -4.52452 0.242
NP_440185.1_9 Forward -398 -381 17.2468 0.189
NP_441159.1_5 Forward -291 -273 4.14905 0.264
NP_440478.1_10 Reverse -369 -383 9.34103 0.253
NP_440191.1_4 Reverse -289 -299 12.5664 0.291
NP_443010.1_10 Reverse -202 -219 3.25396 0.258
NP_441105.1_3 Reverse -348 -367 -2.55715 0.164
NP_440172.1_1 Forward -214 -204 4.40493 0.189
NP_440172.1_1 Reverse -191 -201 4.10993 0.205
NP_440167.1_3 Reverse -343 -362 8.35759 0.28
NP_442834.1_9 Reverse -85 -104 3.24438 0.298
NP_443052.1_8 Forward -273 -254 -13.1769 0.276
NP_443052.1_9 Reverse -280 -299 -4.32711 0.257
NP_440845.1_1 Forward -35 -16 -5.11376 0.239
NP_442154.1_1 Forward -355 -337 -10.0106 0.197
NP_442154.1_1 Reverse -305 -323 -17.5821 0.26
NP_440261.1_5 Forward -199 -186 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTTGCCGGAGGCCAAGCTAGCTAGGGAAGCGGAAATTGCCTACGCCACTTTGGCCCTGGTGACGGACTATGACTGCTGGCACCCAGACCATGACCATGTGACGGTGGAAATGGTGATTGGTAATCTGCAAAAAAATGCGGTCAATGCCCAACAGGTGATCCTGGAAACGGTCAAACAATTGGCGGCCAATCCCTTTGAATCCATTGCCCACAGAGCTTTACAGTATGCGGTGCTAACTCCCCCGGACAAGTTTCCTGCCGCCACCTACGAAAAGTTATCTTTGCTTTTGGGCAAGTATTATCCCCCTGCCCCATGAACCTCCGGTTTGAATCTGGTCGTGCTTTTTTCCGAGCCGGTAAAATGGGGGAATTGACCTTTCACTCGTCTGACTTTTGCCC

CDS

ATGCATCCGGTTGTTAGTTCCGCTGAATATCGTCAACGTCGCGATCGCCTAATGGCCAAGCTAGGCCAGGGGACGGCCATTTTTGCCAGTGCGCCCCAGGCGGTGATGCACAACGATGTGGAATACGTATTTCGTCAAGATAGTGATTTTTATTACCTGACGGGCTTCAATGAACCGGAGGCGATCGCCGTTTTTGCGCCCCACCACGAAGAACATCAATTTATTCTATTTGTGCAACCCAAGGATCCAGCCAAGGAAACCTGGACGGGCATTCGCTACGGTGTGGAGGGGGTTCAATCCAGCTTTGGGTCGGACATTGCCTATCCCATTGGGGAATTGGATGAGCATTTACCGAAATATCTGGAAAAGGCAGATAAAATCCATTACCACCTCGGTCGAGATGAAGCGTTAAATCAAACCATCCTCAAGCACTGGCAAAAACAATTGGCCGCCTATCCCCGCCAAGGCTATGGTCCCCAAGCTTTAGTGAATTCCCATCCCTTGGTGCATCCCCTCCGGCAAGTTAAAAGTGAAACTGAATTAGCCTTGTTGCGGCGGGCCTGTGACCTGTCGGCGATCGCCCATCAACGGGCCATGGAATTTGCTCGACCGGGACATTACGAATATCAAGTGCAGGCGGAATTGGAAATTATTTTTCGGCGGGAAGGGGGCCTGGGGCCGGCTTATCCTTCCATTGTGGCGGCAGGAAAAAATGCCTGTATTTTGCACTACATCAACAATGACTGCCCTTTGCAAGATGGGGATTTACTACTCATCGATGCAGGTTGTGCCTACGGTTACTATAACGGTGACATCACCCGTACCTTTCCCATCAACGGTAAATTTAGTCCCGAACAACGCACCCTCTACGAAATTGTTCTAACTGCCCAGGAAGCGGCGATCGCCAAGGTACAGGCGGGCAATCCCTACCACGAATACCATGATGCGGCAGTGTCCGTGATTGTGGATGGTCTGATGGATTTGGGTCTACTGGTGGGAAATAAGGAGGAAATTATCAAAGAAGAAAAATATAAGCCCTTCTATATGCATCGCACCGGCCATTGGCTGGGGCTAGATGTCCACGATGCCGGCAATTACAAACAGGATAAGGAAACCTGGACGGTGTTGGAGCCAGGGCAAGTGCTCACCGTAGAACCGGGTATTTACATCGCCCCCGATATTAAACCCGCCGAAGGACAGCCGGAAGTGCCGGAACAATGGCGAGGTATTGGCATTCGCATTGAGGATGACGTATTGGTCACTGCCCAAGGCCCCGATGTGTTAACCAGTGCCGTGCCCAAGGCGATCGCCGATTTAGAACATTGA

Protein

MHPVVSSAEYRQRRDRLMAKLGQGTAIFASAPQAVMHNDVEYVFRQDSDFYYLTGFNEPEAIAVFAPHHEEHQFILFVQPKDPAKETWTGIRYGVEGVQSSFGSDIAYPIGELDEHLPKYLEKADKIHYHLGRDEALNQTILKHWQKQLAAYPRQGYGPQALVNSHPLVHPLRQVKSETELALLRRACDLSAIAHQRAMEFARPGHYEYQVQAELEIIFRREGGLGPAYPSIVAAGKNACILHYINNDCPLQDGDLLLIDAGCAYGYYNGDITRTFPINGKFSPEQRTLYEIVLTAQEAAIAKVQAGNPYHEYHDAAVSVIVDGLMDLGLLVGNKEEIIKEEKYKPFYMHRTGHWLGLDVHDAGNYKQDKETWTVLEPGQVLTVEPGIYIAPDIKPAEGQPEVPEQWRGIGIRIEDDVLVTAQGPDVLTSAVPKAIADLEH