Your browser is old and dusty. Try Google Chrome!

Details for sll0107

ORF sll0107
Accession NP_442562.1
Symbol
Category Amino acids and amines
Definition KHG/KDPG aldolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -19 -5 2.85119 0.17
NP_441453.1_4 Reverse -11 -19 6.80426 0.121
NP_441453.1_4 Forward -20 -12 6.11594 0.121
NP_441453.1_4 Reverse -25 -33 4.73931 0.252
NP_441623.1_1 Reverse -117 -135 -2.43913 0.241
NP_442173.1_1 Forward -19 -11 12.0158 0.0316
NP_442173.1_1 Reverse -12 -20 10.7375 0.0611
NP_442752.1_4 Reverse -11 -18 13.8055 0.0199
NP_442975.1_10 Forward -38 -24 6.88214 0.156
NP_440784.1_7 Reverse -12 -19 6.23397 0.241
NP_440784.1_7 Forward -19 -12 6.13563 0.241
NP_442909.1_7 Forward -19 -5 10.5204 0.136
NP_441934.1_8 Reverse -161 -180 14.4541 0.222
NP_440061.1_9 Forward -22 -8 7.17714 0.216
NP_440110.1_8 Forward -233 -214 6.39097 0.137
NP_442062.1_8 Reverse -11 -21 9.32148 0.0633
NP_442242.1_4 Reverse -26 -33 10.7572 0.153
NP_440307.1_2 Reverse -218 -237 2.55606 0.262
NP_441208.1_1 Forward -309 -290 -1.27885 0.25
NP_440132.1_2 Reverse -105 -124 9.83255 0.239
NP_441082.1_10 Reverse -159 -172 10.1474 0.236
NP_442367.1_10 Reverse -170 -184 8.45605 0.279
NP_440273.1_1 Forward -296 -277 18.5728 0.236
NP_441083.1_5 Forward -20 -10 9.7148 0.0231
NP_441083.1_5 Reverse -11 -21 -0.904945 0.283
NP_439957.1_9 Forward -360 -341 8.45061 0.249
NP_442827.1_8 Forward -224 -205 10.6184 0.0597
NP_441434.1_7 Reverse -118 -132 2.16287 0.288
NP_441738.1_2 Forward -18 -11 15.28 0.0102
NP_440209.1_1 Reverse -11 -19 8.57422 0.0425
NP_442889.1_8 Forward -23 -9 8.65209 0.114
NP_442111.1_4 Reverse -10 -24 8.94771 0.0661
NP_442111.1_4 Forward -21 -7 1.67122 0.296
NP_441624.1_7 Reverse -116 -130 11.8976 0.201
NP_440906.1_5 Reverse -12 -19 6.23397 0.234
NP_440906.1_5 Forward -19 -12 6.13563 0.241
NP_440747.1_10 Reverse -8 -20 -2.22263 0.026
NP_440747.1_10 Forward -23 -11 -2.61596 0.0556
NP_440747.1_10 Forward -393 -381 -12.2524 0.254
NP_441130.1_8 Reverse -181 -200 11.9958 0.21
NP_441486.1_1 Reverse -22 -36 -5.60527 0.248
NP_440470.1_4 Forward -141 -125 18.6431 0.125
NP_441014.1_5 Forward -237 -219 11.6222 0.258
NP_441014.1_10 Forward -193 -174 4.81688 0.196
NP_442848.1_1 Reverse -5 -19 7.76774 0.0791
NP_441012.1_4 Reverse -303 -316 10.4424 0.262
NP_441012.1_4 Forward -18 -5 7.09911 0.272
NP_443018.1_3 Forward -19 -12 11.7405 0.0655
NP_443018.1_3 Reverse -12 -19 5.44732 0.193
NP_440376.1_1 Reverse -11 -20 5.99792 0.111
NP_440376.1_1 Reverse -381 -390 2.16301 0.233
NP_440376.1_1 Forward -234 -225 2.06468 0.236
NP_440376.1_1 Forward -20 -11 -0.196935 0.285
NP_442687.1_7 Reverse -224 -234 3.61828 0.299
NP_442485.1_3 Reverse -223 -242 -1.37718 0.257
NP_441846.1_6 Forward -360 -341 4.62101 0.205
NP_441846.1_10 Forward -141 -122 -11.6036 0.19
NP_441846.1_10 Forward -143 -124 -19.7651 0.256
NP_441846.1_10 Forward -149 -130 -22.42 0.259
NP_440642.1_10 Reverse -130 -144 1.27731 0.296
NP_441013.1_2 Forward -227 -209 -3.91409 0.295
NP_441013.1_2 Forward -25 -7 -5.09406 0.3
NP_441013.1_3 Reverse -223 -242 6.78429 0.28
NP_440042.1_2 Forward -236 -217 -4.52377 0.293
NP_441422.1_7 Forward -22 -5 -0.747806 0.168
NP_441029.1_8 Forward -20 -1 12.0933 0.244
NP_440360.1_10 Reverse -219 -233 1.76955 0.289
NP_442658.1_1 Forward -22 -12 5.58445 0.262
NP_441855.2_4 Reverse -217 -236 9.52306 0.275
NP_442782.1_2 Reverse -11 -25 0.982901 0.282
NP_441414.1_9 Reverse -11 -30 -3.93378 0.143
NP_441414.1_9 Forward -226 -207 -6.68705 0.201
NP_442937.1_5 Forward -75 -56 6.09597 0.288
NP_441958.1_5 Reverse -10 -20 0.865012 0.12
NP_441127.1_1 Forward -310 -296 8.84938 0.284
NP_440203.1_5 Forward -17 -7 15.7125 0.0611
NP_440203.1_5 Reverse -210 -220 9.02601 0.275
NP_439905.1_1 Forward -172 -159 6.90245 0.272
NP_439905.1_2 Reverse -153 -167 9.83269 0.228
NP_442911.1_2 Forward -30 -11 -8.55534 0.237
NP_441591.1_10 Forward -137 -118 5.89931 0.295
NP_442064.1_4 Reverse -1 -20 11.6017 0.174
NP_442064.1_4 Reverse -153 -172 7.96345 0.237
NP_443055.1_6 Reverse -217 -235 5.52492 0.179
NP_441294.1_7 Forward -24 -10 9.34661 0.249
NP_442438.1_10 Forward -25 -11 4.32615 0.148
NP_441000.1_6 Reverse -10 -24 -3.73699 0.225
NP_441000.1_6 Forward -227 -213 -5.60527 0.285
NP_440147.1_4 Forward -36 -23 14.0806 0.0279
NP_441550.1_8 Reverse -9 -19 11.091 0.0555
NP_441550.1_8 Forward -228 -218 10.796 0.0625
NP_441550.1_8 Forward -22 -12 4.60114 0.299
NP_441916.1_7 Reverse -25 -35 3.61828 0.208
NP_441725.1_5 Forward -19 -9 1.455 0.135
NP_441725.1_5 Reverse -117 -127 -0.511621 0.26
NP_439966.1_7 Forward -22 -12 14.4342 0.0203
NP_439966.1_7 Reverse -9 -19 6.0761 0.195
NP_442941.1_3 Forward -19 -9 10.1081 0.024
NP_440289.1_2 Forward -136 -123 -2.34066 0.254
NP_442281.1_1 Reverse -6 -20 6.0955 0.136
NP_440437.1_1 Forward -26 -7 -2.45882 0.219
NP_442012.1_1 Reverse -19 -38 5.30933 0.153
NP_442049.1_6 Reverse -3 -22 8.55425 0.215
NP_441087.1_6 Reverse -108 -126 -1.35821 0.264
NP_441556.1_7 Forward -183 -164 -1.27961 0.3
NP_441644.1_6 Forward -20 -10 7.74772 0.117
NP_443049.1_6 Reverse -10 -20 11.8361 0.24
NP_442501.1_2 Reverse -122 -141 -2.95047 0.255
NP_440929.1_8 Forward -20 -11 14.651 0.0105
NP_440929.1_8 Reverse -11 -20 7.66954 0.0624
NP_441751.2_8 Forward -19 -5 -1.67204 0.13
NP_442554.1_8 Reverse -12 -22 8.4365 0.0744
NP_442554.1_8 Forward -19 -9 6.07655 0.126
NP_442554.1_8 Reverse -117 -127 2.92996 0.249
NP_441762.1_7 Forward -35 -23 3.67722 0.0676
NP_441762.1_7 Reverse -24 -36 -7.63084 0.296
NP_442142.1_4 Reverse -113 -126 8.67183 0.111
NP_442292.1_1 Forward -19 -10 8.65285 0.0335
NP_442292.1_1 Reverse -12 -21 -0.68859 0.268
NP_442476.1_6 Reverse -226 -240 0.491246 0.258
NP_442476.1_6 Reverse -12 -26 -0.197071 0.29
NP_443009.1_5 Reverse -10 -21 7.53132 0.126
NP_443009.1_5 Reverse -224 -235 6.74468 0.15
NP_442408.2_1 Reverse -374 -393 -6.98204 0.287
NP_441715.1_4 Forward -19 -9 4.99491 0.24
NP_440357.1_3 Forward -237 -218 3.73603 0.242
NP_440379.1_6 Reverse -11 -30 9.24257 0.192
NP_441468.1_1 Reverse -12 -19 6.13563 0.209
NP_441468.1_1 Forward -19 -12 6.0373 0.223
NP_441020.2_6 Reverse -9 -26 7.02034 0.245
NP_441015.1_8 Forward -146 -127 1.17943 0.272
NP_441015.1_10 Reverse -6 -25 -3.73712 0.191
NP_441015.1_10 Forward -130 -111 -7.57203 0.269
NP_441015.1_10 Forward -143 -124 -11.6036 0.298
NP_441673.1_1 Reverse -11 -20 1.37636 0.114
NP_441673.1_1 Forward -20 -11 1.1797 0.163
NP_441244.1_8 Forward -146 -127 4.42435 0.144
NP_441731.1_3 Reverse -3 -22 -5.40875 0.284
NP_441876.1_9 Forward -177 -167 14.4342 0.267
NP_441876.1_9 Forward -230 -220 14.3359 0.267
NP_441876.1_9 Forward -49 -39 10.5993 0.287
NP_441826.1_2 Reverse -5 -19 10.3243 0.0487
NP_441826.1_2 Reverse -19 -33 -1.77037 0.254
NP_442811.1_2 Forward -240 -221 -2.26216 0.281
NP_442490.1_9 Forward -238 -219 -5.50708 0.273
NP_442868.1_6 Reverse -9 -19 0.176696 0.247
NP_441056.1_1 Forward -20 -1 -5.9004 0.265
NP_442361.1_3 Reverse -5 -18 13.589 0.14
NP_442427.1_8 Reverse -60 -79 5.211 0.274
NP_442808.1_1 Forward -21 -11 10.4026 0.0481
NP_442808.1_1 Forward -174 -164 6.37109 0.116
NP_442808.1_1 Reverse -115 -125 5.78111 0.141
NP_441101.1_10 Reverse -118 -137 -4.13045 0.273
NP_440145.1_3 Reverse -1 -20 -3.93378 0.214
NP_442820.1_3 Forward -235 -225 13.0576 0.284
NP_442542.1_2 Forward -22 -9 4.64084 0.299
NP_442113.1_10 Reverse -109 -128 -6.98204 0.265
NP_442050.1_1 Forward -143 -124 17.5024 0.171
NP_442050.1_1 Forward -314 -295 7.7676 0.261
NP_442050.1_5 Reverse -9 -19 6.76441 0.282
NP_440038.1_4 Reverse -297 -316 0.294447 0.277
NP_442747.1_1 Forward -143 -124 -17.1101 0.247
NP_442789.1_4 Forward -233 -214 -1.37718 0.219
NP_441878.1_6 Forward -126 -116 0.668351 0.139
NP_441036.1_8 Forward -21 -11 7.45319 0.197
NP_441557.1_5 Forward -20 -11 7.57121 0.049
NP_441557.1_5 Reverse -11 -20 1.08137 0.0794
NP_441557.1_5 Reverse -25 -34 -0.786921 0.239
NP_441557.1_8 Reverse -132 -142 13.5492 0.216
NP_441557.1_8 Reverse -125 -135 11.7793 0.239
NP_441433.1_8 Reverse -159 -178 3.34271 0.208
NP_441433.1_8 Reverse -355 -374 -1.57384 0.262
NP_440101.1_3 Forward -25 -6 2.85105 0.244
NP_441458.1_10 Reverse -2 -21 6.78429 0.196
NP_441458.1_10 Forward -29 -10 2.16274 0.273
NP_441458.1_10 Reverse -308 -327 1.0811 0.298
NP_442347.1_2 Forward -19 -10 10.3245 0.058
NP_442347.1_2 Forward -191 -182 4.22796 0.284
NP_441037.1_4 Reverse -223 -233 5.95329 0.289
NP_442594.1_8 Forward -149 -130 5.40766 0.247
NP_442594.1_8 Forward -142 -123 1.86774 0.295
NP_441633.1_3 Forward -22 -9 -2.43899 0.177
NP_441633.1_3 Forward -36 -23 -5.48725 0.236
NP_440136.1_2 Reverse -12 -19 6.23397 0.171
NP_440136.1_2 Forward -19 -12 6.13563 0.193
NP_442998.1_5 Reverse -66 -76 13.5497 0.158
NP_442998.1_5 Reverse -285 -295 8.63316 0.261
NP_442998.1_10 Forward -18 -11 15.5754 0.0102
NP_440299.1_1 Reverse -7 -20 4.24695 0.213
NP_440299.1_1 Forward -24 -11 3.26365 0.251
NP_441799.1_1 Reverse -21 -35 3.73557 0.284
NP_440256.1_1 Reverse -8 -27 4.916 0.0408
NP_441559.1_8 Forward -187 -173 4.71948 0.111
NP_441559.1_8 Forward -238 -224 1.57289 0.155
NP_441559.1_8 Forward -221 -207 -6.39192 0.277
NP_441179.1_9 Reverse -114 -124 9.616 0.28
NP_442866.1_1 Forward -25 -6 -2.95047 0.216
NP_440748.1_5 Reverse -7 -26 6.09597 0.188
NP_442386.1_9 Forward -21 -12 10.619 0.121
NP_442386.1_9 Forward -174 -165 8.2591 0.205
NP_442386.1_9 Reverse -115 -124 4.52254 0.297
NP_441340.1_5 Reverse -12 -19 13.5105 0.0314
NP_441340.1_5 Forward -19 -12 5.84064 0.208
NP_442484.1_2 Reverse -153 -172 -0.39387 0.262
NP_441248.1_9 Reverse -47 -66 16.5182 0.294
NP_442474.1_9 Reverse -211 -230 8.84924 0.264
NP_442240.1_2 Reverse -12 -31 -19.6667 0.295
NP_440586.1_8 Forward -19 -12 9.47853 0.146
NP_440586.1_8 Forward -124 -117 5.8403 0.283
NP_440586.1_8 Forward -13 -6 5.8403 0.283
NP_440586.1_8 Reverse -12 -19 5.74197 0.283
NP_441262.1_3 Reverse -11 -18 14.7888 0.0223
NP_443051.1_1 Reverse -10 -19 7.47288 0.0571
NP_439937.1_8 Reverse -181 -200 11.7008 0.173
NP_439937.1_9 Forward -184 -167 -11.6632 0.261
NP_439937.1_9 Forward -185 -168 -15.1047 0.287
NP_440408.1_7 Forward -173 -154 7.07928 0.292
NP_440439.1_1 Reverse -22 -35 1.88757 0.139
NP_440439.1_1 Forward -23 -10 -1.849 0.285
NP_440372.1_2 Reverse -12 -19 13.8055 0.0214
NP_440372.1_2 Forward -19 -12 6.52896 0.188
NP_440819.1_5 Reverse -273 -281 6.41093 0.285
NP_440316.1_10 Forward -126 -116 8.92815 0.236
NP_439977.1_5 Forward -26 -7 3.44104 0.159
NP_441572.1_7 Reverse -5 -24 -2.26216 0.193
NP_442384.1_10 Forward -20 -7 5.32916 0.131
NP_440693.1_8 Forward -137 -118 11.2092 0.287
NP_442262.1_10 Forward -19 -12 13.2155 0.0213
NP_441689.1_5 Reverse -9 -19 12.7626 0.113
NP_440163.1_10 Reverse -8 -18 12.4681 0.159
NP_440531.1_6 Forward -22 -3 -3.83545 0.272
NP_442123.1_3 Forward -234 -215 12.4875 0.2
NP_441060.1_3 Reverse -319 -338 9.83255 0.218
NP_441965.1_10 Reverse -222 -238 4.87675 0.228
NP_440297.1_9 Reverse -117 -127 9.32148 0.0917
NP_440297.1_9 Forward -19 -9 -0.511621 0.289
NP_442280.1_10 Reverse -154 -172 5.84403 0.281
NP_441592.1_10 Forward -288 -274 18.9768 0.279
NP_440700.1_8 Reverse -21 -35 10.7177 0.291
NP_440937.1_5 Reverse -157 -176 8.06259 0.287
NP_440999.1_2 Forward -227 -208 15.4374 0.155
NP_440999.1_9 Forward -35 -21 0.196253 0.191
NP_440999.1_9 Forward -24 -10 -0.688726 0.214
NP_441917.1_2 Forward -128 -110 5.13236 0.288
NP_441543.1_2 Forward -33 -24 7.27622 0.13
NP_441543.1_2 Forward -19 -10 7.07956 0.131
NP_442845.1_2 Reverse -5 -19 5.80112 0.224
NP_442845.1_2 Forward -20 -6 4.03116 0.271
NP_441551.1_5 Forward -24 -8 9.39927 0.21
NP_441469.1_8 Forward -21 -12 6.68623 0.227
NP_441469.1_8 Reverse -24 -33 5.01461 0.297
NP_442578.1_7 Reverse -12 -19 6.0373 0.18
NP_441462.1_2 Reverse -11 -21 0.963343 0.109
NP_443062.1_1 Reverse -11 -29 4.2556 0.268
NP_441601.1_10 Reverse -162 -181 3.34271 0.256
NP_440519.1_8 Forward -63 -47 0.845183 0.298
NP_442204.1_1 Reverse -7 -18 9.69511 0.0736
NP_440516.1_8 Reverse -11 -20 9.53783 0.0136
NP_440516.1_8 Forward -20 -11 5.01461 0.118
NP_442428.1_5 Reverse -12 -19 6.13563 0.209
NP_442428.1_5 Forward -19 -12 6.0373 0.212
NP_441443.1_1 Forward -141 -122 -5.60541 0.298
NP_441443.1_2 Reverse -108 -127 0.0977854 0.26
NP_442120.1_10 Reverse -25 -44 -11.5053 0.262
NP_440673.1_3 Forward -18 -11 12.4288 0.0426
NP_440865.1_9 Reverse -25 -44 -9.34199 0.285
NP_441052.1_2 Forward -20 -10 1.55333 0.238
NP_442219.1_9 Forward -19 -10 7.96454 0.0696
NP_440436.1_4 Forward -19 -10 7.57079 0.124
NP_441884.1_8 Reverse -10 -29 -7.08038 0.241
NP_441884.1_8 Reverse -24 -43 -11.8986 0.271
NP_441884.1_9 Forward -114 -95 -13.2752 0.138
NP_441884.1_9 Reverse -104 -123 -23.2067 0.284
NP_440041.1_2 Reverse -156 -175 -6.29373 0.296
NP_441719.1_4 Reverse -12 -19 6.82395 0.0855
NP_441719.1_4 Forward -19 -12 6.52896 0.188
NP_441004.1_1 Forward -375 -356 -16.5201 0.286
NP_442813.1_4 Reverse -373 -392 -2.0655 0.262
NP_442813.1_4 Reverse -257 -276 -3.04881 0.288
NP_442813.1_4 Reverse -156 -175 -4.03212 0.296
NP_442813.1_4 Reverse -3 -22 -8.45701 0.299
NP_442366.1_3 Forward -21 -3 4.9357 0.0899
NP_442366.1_5 Forward -73 -63 10.4026 0.271
NP_440129.1_10 Reverse -4 -18 6.98109 0.177
NP_440296.1_10 Forward -143 -124 -15.4385 0.298
NP_441115.1_4 Forward -275 -257 7.3932 0.286
NP_442206.1_10 Reverse -11 -26 1.65152 0.222
NP_442206.1_10 Forward -20 -5 0.963207 0.241
NP_441851.1_10 Reverse -10 -20 5.97822 0.19
NP_441851.1_10 Forward -21 -11 4.60159 0.259
NP_441851.1_10 Reverse -224 -234 4.40493 0.271
NP_441542.1_4 Reverse -282 -296 4.12949 0.264
NP_442011.1_1 Reverse -10 -29 -1.96717 0.271
NP_442515.1_1 Reverse -44 -58 2.75286 0.13
NP_440463.1_7 Reverse -222 -236 17.6008 0.182
NP_442689.1_4 Forward -87 -68 16.7157 0.0344
NP_442024.1_4 Forward -119 -100 12.6841 0.197
NP_441124.1_5 Forward -289 -279 12.7217 0.215
NP_440877.1_1 Reverse -287 -306 9.53756 0.296
NP_442168.1_5 Forward -233 -214 2.94938 0.232
NP_440588.1_2 Reverse -2 -21 -4.22878 0.21
NP_442006.1_2 Forward -125 -108 -15.6941 0.228
NP_442006.1_2 Reverse -164 -181 -16.4808 0.254
NP_441570.1_1 Reverse -5 -23 -16.8938 0.257
NP_441078.1_4 Reverse -11 -20 0.196389 0.205
NP_441078.1_4 Forward -20 -11 -0.000272808 0.205
NP_441078.1_4 Forward -34 -25 -1.27858 0.246
NP_442729.1_5 Forward -126 -116 18.2696 0.059
NP_441663.1_7 Reverse -8 -27 7.47261 0.209
NP_441663.1_8 Forward -26 -7 -3.14714 0.276
NP_442443.1_1 Forward -242 -223 3.83436 0.166
NP_441432.1_8 Reverse -10 -19 14.0611 0.0258
NP_442320.1_8 Reverse -5 -19 -6.29359 0.277
NP_441732.1_2 Forward -44 -28 -16.8544 0.207
NP_442003.1_9 Forward -377 -358 15.2408 0.154
NP_440760.1_6 Forward -141 -122 13.2741 0.283
NP_442797.1_7 Reverse -216 -234 3.26407 0.234
NP_440199.1_10 Reverse -8 -18 7.64985 0.231
NP_440199.1_10 Forward -128 -118 6.56821 0.296
NP_441057.1_3 Forward -242 -223 -11.5053 0.236
NP_441072.1_2 Reverse -21 -40 5.80098 0.296
NP_440713.1_4 Forward -226 -207 2.85105 0.256
NP_442489.1_7 Forward -20 -11 0.688044 0.152
NP_442489.1_7 Reverse -11 -20 0.688044 0.152
NP_440559.1_1 Forward -19 -10 7.76787 0.0918
NP_440559.1_1 Reverse -12 -21 5.11294 0.151
NP_441659.2_8 Forward -20 -10 5.48657 0.106
NP_441040.1_2 Forward -243 -224 -8.65367 0.236
NP_441040.1_2 Reverse -107 -126 -12.5869 0.259
NP_441040.1_2 Forward -318 -299 -14.0619 0.284
NP_441040.1_2 Forward -29 -10 -16.2252 0.294
NP_442008.1_2 Reverse -8 -27 12.6841 0.0982
NP_440779.1_5 Forward -234 -217 -14.4158 0.246
NP_442346.1_5 Forward -15 -5 9.02648 0.118
NP_442346.1_5 Reverse -10 -20 6.27322 0.208
NP_442346.1_5 Forward -126 -116 6.17489 0.212
NP_442346.1_10 Reverse -120 -139 -2.65548 0.294
NP_440545.1_3 Reverse -7 -24 0.530496 0.137
NP_441923.1_6 Forward -124 -110 18.3875 0.109
NP_441888.1_7 Reverse -158 -172 2.16287 0.225
NP_441948.1_4 Forward -27 -9 -5.09406 0.253
NP_441502.1_3 Forward -392 -373 4.32602 0.299
NP_441833.1_4 Forward -19 -12 6.52896 0.0924
NP_441833.1_4 Reverse -12 -19 6.23397 0.163
NP_441329.1_6 Reverse -174 -193 4.15348 0.206
NP_441895.1_10 Forward -108 -89 -18.9784 0.282
NP_442162.1_8 Forward -26 -7 -3.14714 0.291
NP_442162.1_9 Forward -19 -12 12.9205 0.0282
NP_442162.1_9 Reverse -12 -19 12.9205 0.0282
NP_442796.1_2 Forward -394 -375 15.0733 0.24
NP_440671.1_4 Reverse -5 -19 19.2725 0.00971
NP_440671.1_4 Forward -274 -260 5.70279 0.275
NP_442045.1_5 Reverse -298 -317 -0.688862 0.269
NP_442140.1_3 Forward -124 -114 11.6814 0.0738
NP_442140.1_3 Reverse -12 -22 5.97822 0.189
NP_442140.1_3 Forward -13 -3 5.68323 0.198
NP_442140.1_3 Reverse -218 -228 4.3066 0.248
NP_442723.1_1 Reverse -124 -143 2.85027 0.282
NP_441609.1_1 Forward -76 -57 -1.67217 0.272
NP_441813.1_5 Forward -22 -12 15.5163 0.0106
NP_441813.1_5 Reverse -9 -19 6.17489 0.1
NP_440567.1_1 Forward -33 -19 -0.492064 0.287
NP_442497.1_10 Forward -19 -10 0.589713 0.153
NP_442497.1_10 Reverse -12 -21 -1.18024 0.256
NP_440821.1_4 Reverse -9 -19 8.53483 0.0468
NP_440821.1_4 Forward -22 -12 -0.216628 0.244
NP_440821.1_4 Reverse -23 -33 -0.511621 0.269
NP_441239.1_9 Forward -22 -10 12.9203 0.0402
NP_441239.1_9 Reverse -114 -126 6.43049 0.189
NP_441239.1_9 Reverse -129 -141 4.36554 0.253
NP_441239.1_9 Forward -175 -163 3.2839 0.289
NP_440665.1_2 Reverse -36 -55 -5.9004 0.247
NP_441617.1_6 Reverse -279 -298 8.16093 0.121
NP_441617.1_6 Forward -295 -276 2.26107 0.2
NP_440412.1_2 Forward -316 -297 8.06259 0.281
NP_440546.1_4 Forward -125 -115 8.78555 0.171
NP_440462.1_6 Forward -22 -12 5.68323 0.145
NP_442340.1_3 Reverse -209 -228 -10.227 0.284
NP_442611.1_1 Reverse -11 -30 -1.47551 0.282
NP_440868.1_4 Reverse -7 -19 3.57889 0.134
NP_440868.1_4 Forward -24 -12 0.23564 0.224
NP_440868.1_4 Reverse -21 -33 0.137309 0.228
NP_442787.1_5 Forward -274 -255 6.78429 0.27
NP_442479.1_9 Reverse -277 -296 -7.17871 0.266
NP_442479.1_9 Forward -297 -278 -8.85033 0.266
NP_442479.1_9 Forward -270 -251 -11.3086 0.273
NP_441672.1_6 Reverse -121 -140 10.3234 0.294
NP_442402.1_2 Forward -184 -170 12.6836 0.269
NP_442402.1_4 Forward -188 -169 -0.00131823 0.186
NP_442402.1_4 Forward -203 -184 -10.031 0.296
NP_441848.1_4 Reverse -279 -295 8.50558 0.288
NP_441848.1_7 Forward -187 -168 4.03023 0.217
NP_441848.1_7 Reverse -75 -94 -3.04956 0.274
NP_440696.1_3 Forward -24 -6 3.46073 0.206
NP_442039.1_4 Reverse -12 -19 11.6422 0.0747
NP_442039.1_4 Reverse -26 -33 8.29892 0.213
NP_442837.1_3 Forward -19 -12 6.0373 0.25
NP_442837.1_3 Reverse -12 -19 6.0373 0.25
NP_440160.1_2 Forward -173 -154 -8.85033 0.291
NP_442053.1_1 Forward -20 -11 7.07956 0.105
NP_440505.1_3 Reverse -9 -19 14.7297 0.0176
NP_440505.1_7 Forward -186 -167 4.03102 0.207
NP_441701.1_3 Forward -329 -312 6.52869 0.285
NP_441959.1_10 Reverse -10 -28 14.0311 0.186
NP_440914.1_1 Forward -20 -10 6.56569 0.273
NP_441011.1_8 Reverse -12 -21 5.70292 0.237
NP_441011.1_8 Forward -319 -310 5.60459 0.247
NP_442533.1_6 Reverse -225 -234 5.50626 0.14
NP_442533.1_6 Forward -20 -11 4.42462 0.179
NP_442541.1_10 Reverse -122 -136 5.80051 0.248
NP_442541.1_10 Reverse -131 -145 5.21053 0.248
NP_442322.1_4 Reverse -109 -126 -8.61494 0.286
NP_441482.1_7 Reverse -5 -19 7.9644 0.0215
NP_439944.1_9 Forward -19 -9 9.22315 0.1
NP_441028.1_6 Forward -178 -168 8.3377 0.216
NP_442202.1_10 Forward -227 -213 5.30946 0.255
NP_441527.1_4 Forward -147 -128 -7.78302 0.237
NP_441527.1_4 Forward -362 -343 -12.4621 0.288
NP_441527.1_7 Reverse -127 -146 8.75009 0.282
NP_440115.1_6 Reverse -42 -52 10.6981 0.115
NP_440115.1_6 Reverse -8 -18 9.41981 0.115
NP_440007.1_9 Reverse -7 -21 9.04604 0.171
NP_440007.1_9 Forward -387 -373 7.37441 0.211
NP_442728.1_7 Forward -173 -159 16.8142 0.196
NP_439965.1_1 Reverse -2 -21 -9.73531 0.296
NP_441972.1_3 Forward -144 -125 15.8307 0.146
NP_441972.1_5 Forward -233 -214 -5.60541 0.224
NP_441825.1_4 Forward -378 -368 17.6796 0.158
NP_441869.1_9 Forward -327 -308 15.6341 0.219
NP_442306.1_10 Forward -239 -220 -12.1936 0.166
NP_442306.1_10 Reverse -212 -231 -13.3736 0.197
NP_441286.1_1 Forward -21 -9 0.727295 0.108
NP_440670.1_8 Reverse -11 -20 16.0277 0.00443
NP_440670.1_8 Forward -20 -11 12.5861 0.0253
NP_440886.1_7 Forward -21 -11 7.64939 0.0865
NP_440886.1_7 Forward -35 -25 6.56775 0.118
NP_440828.1_4 Reverse -106 -125 -0.197979 0.19
NP_442614.1_2 Reverse -11 -25 10.0294 0.235
NP_440907.2_8 Forward -33 -23 4.99446 0.228
NP_442264.1_2 Reverse -1 -18 10.0686 0.188
NP_441626.1_2 Reverse -12 -19 12.2322 0.0511
NP_441626.1_2 Forward -19 -12 5.93897 0.231
NP_442211.1_3 Forward -280 -261 12.5297 0.243
NP_442365.1_7 Reverse -7 -26 -2.16383 0.199
NP_442365.1_7 Reverse -297 -316 -3.73712 0.222
NP_440107.1_2 Reverse -6 -25 10.4225 0.299
NP_442794.1_1 Reverse -7 -19 9.97041 0.0742
NP_440387.1_1 Forward -34 -18 -2.98973 0.153
NP_440387.1_1 Reverse -25 -41 -5.93965 0.258
NP_440855.1_1 Reverse -311 -330 -1.67217 0.288
NP_441431.1_2 Reverse -22 -36 7.47213 0.241
NP_441836.1_2 Forward -179 -160 -1.67217 0.223
NP_441174.1_4 Forward -137 -127 12.9597 0.267
NP_442352.1_1 Forward -232 -219 15.3643 0.227
NP_440814.1_8 Forward -136 -117 7.66927 0.269
NP_440114.1_10 Reverse -116 -130 11.3077 0.118
NP_442698.1_10 Forward -144 -125 -1.27885 0.297
NP_442357.1_8 Reverse -185 -204 7.96426 0.241
NP_440492.1_9 Forward -356 -342 18.9227 0.193
NP_441510.2_7 Reverse -5 -19 15.0436 0.28
NP_440766.1_4 Reverse -7 -21 13.0776 0.0421
NP_442930.1_1 Reverse -240 -250 10.8943 0.264
NP_440457.1_1 Reverse -7 -19 10.5604 0.092
NP_440798.1_6 Reverse -12 -25 11.4257 0.0614
NP_440798.1_6 Forward -33 -20 -0.0790467 0.297
NP_440801.1_8 Reverse -60 -79 8.06259 0.142
NP_440942.1_6 Reverse -36 -55 6.29183 0.259
NP_441984.1_8 Forward -144 -130 18.7808 0.191
NP_441332.1_6 Forward -227 -217 10.8723 0.282
NP_442130.1_9 Reverse -105 -124 7.86593 0.267
NP_442509.1_6 Reverse -171 -190 8.35759 0.294
NP_442509.1_9 Reverse -11 -21 9.71433 0.192
NP_440554.1_4 Reverse -12 -22 8.04317 0.0851
NP_440554.1_4 Forward -19 -9 4.10993 0.201
NP_440554.1_4 Forward -225 -215 2.14332 0.276
NP_442737.1_5 Reverse -4 -23 15.8846 0.165
NP_441885.1_5 Forward -20 -10 1.25834 0.11
NP_441885.1_5 Reverse -11 -21 0.0783647 0.183
NP_442703.1_8 Forward -63 -45 11.0314 0.265
NP_442341.1_7 Forward -21 -7 6.29277 0.13
NP_442341.1_7 Forward -391 -377 3.34284 0.227
NP_442341.1_9 Forward -22 -8 14.3553 0.0695
NP_441173.1_9 Forward -292 -284 13.2937 0.17
NP_441173.1_9 Forward -177 -169 10.1471 0.261
NP_442395.2_4 Forward -287 -268 2.26028 0.223
NP_443000.1_7 Reverse -9 -19 7.35486 0.0859
NP_440275.1_3 Forward -22 -12 5.87989 0.13
NP_440275.1_3 Reverse -9 -19 5.5849 0.14
NP_440091.1_1 Reverse -21 -33 0.137309 0.265
NP_441902.1_3 Reverse -168 -178 12.9817 0.23
NP_442451.1_2 Forward -242 -223 -5.50708 0.224
NP_440149.1_8 Forward -131 -112 3.04771 0.102
NP_441105.1_3 Reverse -218 -237 -8.35868 0.272
NP_440216.1_1 Reverse -11 -25 7.07942 0.01
NP_440216.1_9 Forward -171 -162 5.50626 0.292
NP_440172.1_1 Forward -20 -10 2.24165 0.279
NP_442015.1_10 Forward -24 -11 11.4257 0.0372
NP_442015.1_10 Reverse -7 -20 -0.37404 0.264
NP_441226.1_7 Reverse -12 -19 12.7234 0.0312
NP_441226.1_7 Forward -19 -12 11.5435 0.0757
NP_441226.1_7 Forward -225 -218 9.47853 0.147
NP_441226.1_7 Reverse -226 -233 8.29857 0.205
NP_441111.1_7 Forward -19 -11 8.86921 0.0589
NP_439971.2_8 Forward -138 -124 17.9942 0.15
NP_439971.2_8 Forward -140 -126 15.2409 0.217
NP_441766.1_2 Forward -20 -11 12.6844 0.0158
NP_440416.1_9 Forward -27 -8 2.0644 0.0413
NP_440416.1_9 Reverse -4 -23 0.196116 0.0549
NP_440416.1_9 Reverse -374 -393 -18.3884 0.256
NP_440988.1_10 Reverse -299 -313 6.06058 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATAGATCCTGCCTAAAGCCGAAGGGATTTTCGTAATGGTAAAGAGCTAAAACAATTAACCAATTAACTAACTCTGCCGTAGTTAAGGCTGGCTGTTGGGACAAAGCATTTTGCCAAAATCTTTCCGGCAAAGGAGTTTGGTAAGGCTCGGATAATATGTACTGCCAGGGTTGGCCCCATCGGAGGCAATTAGCTTGATTCTGATGGTTTTCATCCCAGTCTTTTCCCCCCAAGGCCAGGAGTAAGGAAGCTTGAAAGCGGGAGAGGGGAGAAAGGGCCATGGTGGAGCGGTAATCTGGAACAGTGTTGAATGTAGGAAGTTTGGAATTTGTCCATCATTGATGATTTTGGTTGCCCCCAGGAGTCAGCTATCTCCGCCCTCCGATCGCCATGGTTAAAA

CDS

ATGTTGCGACAGCACCGGGCGATCGCCGTTATTCGCACTGATTCCATCGACCTAAGTCTGCAATTGGCTAAGGTGGCCATCGAAGCAGGCATGGGGCTAGTGGAAATTACCTGGAACAGTGACCAGCCGGGGGAAACCATTGCTCACCTGCGTCATCAATTTCCCCATTGTGCCATTGGTACGGGTACAGTCCTCTCTCAGGAGGATTTGCTCCAGGCCGTTGCCAGTGGAGCCCAATTTTGCTTTACCCCCCACAGTGAGCCAGAATTAATTACCAGCGCCGTGGCCCATGGCATCCCCATTATTCCCGGTGCCTTTTCCCCTACGGAGATTGTCCAAGCCTGGCAGAGGGGAGCCACCGCCGTCAAAGTTTTTCCCATTAAAACCTTGGGAGGAGTGGACTACATTCAAGCTCTCCAAGGTCCCCTCGGCCAAATTCCCCTTATTCCCACCGGAGGGGTAACTTTGGCAAATGCCCAAGCTTTCCTAGCGGCCGGAGCGATCGCCGTTGGCCTATCTGGACAGCTATTCCCCCCCAATTTAGTAGCAATCAAAGCCTGGAGAGAAATTGGCGATCTAATCCGTACTTTGTTGAAAGAAATCCAGACACCAAGGGGCTGA

Protein

MLRQHRAIAVIRTDSIDLSLQLAKVAIEAGMGLVEITWNSDQPGETIAHLRHQFPHCAIGTGTVLSQEDLLQAVASGAQFCFTPHSEPELITSAVAHGIPIIPGAFSPTEIVQAWQRGATAVKVFPIKTLGGVDYIQALQGPLGQIPLIPTGGVTLANAQAFLAAGAIAVGLSGQLFPPNLVAIKAWREIGDLIRTLLKEIQTPRG