Your browser is old and dusty. Try Google Chrome!

Details for sll0102

ORF sll0102
Accession NP_442566.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_3 Reverse -147 -166 9.7875 0.287
NP_443027.1_4 Reverse -92 -102 9.32148 0.166
NP_442062.1_8 Forward -396 -386 4.69992 0.201
NP_441995.1_6 Reverse -230 -249 13.4708 0.286
NP_440304.1_4 Forward -140 -130 4.10993 0.272
NP_441492.1_1 Reverse -299 -318 9.93088 0.201
NP_439918.1_2 Reverse -235 -254 -1.96717 0.24
NP_441083.1_3 Reverse -114 -124 14.1392 0.195
NP_442889.1_8 Reverse -91 -105 6.19383 0.199
NP_442570.1_3 Reverse -232 -251 -2.16383 0.212
NP_442570.1_3 Reverse -231 -250 -8.16202 0.281
NP_440538.1_10 Reverse -307 -326 12.2908 0.235
NP_441327.1_5 Forward -262 -253 15.0444 0.191
NP_440747.1_10 Reverse -112 -124 -12.1541 0.227
NP_441130.1_10 Reverse -110 -124 5.80112 0.214
NP_441634.1_8 Forward -105 -91 2.35953 0.168
NP_441588.1_4 Reverse -1 -11 6.07655 0.214
NP_441588.1_4 Reverse -389 -399 5.48657 0.258
NP_441077.1_2 Forward -190 -171 0.524783 0.299
NP_440642.1_10 Reverse -256 -270 5.99717 0.238
NP_440741.1_4 Reverse -94 -113 13.9625 0.215
NP_440533.1_9 Reverse -94 -113 1.86774 0.297
NP_440184.1_7 Reverse -170 -189 17.807 0.119
NP_440184.1_10 Reverse -66 -85 12.7816 0.254
NP_441958.1_5 Forward -397 -387 -1.98659 0.265
NP_441097.1_2 Reverse -231 -248 13.3135 0.142
NP_440827.1_3 Forward -114 -95 12.3892 0.254
NP_441654.1_7 Reverse -300 -319 16.6961 0.155
NP_442567.1_4 Reverse -122 -141 24.4839 0.0118
NP_442431.1_10 Reverse -235 -253 -0.472507 0.289
NP_442566.1_5 Forward -369 -350 19.0748 0.0706
NP_440377.1_1 Reverse -158 -175 13.7862 0.224
NP_441674.1_6 Reverse -101 -120 2.75272 0.275
NP_440147.1_4 Forward -398 -385 3.36254 0.188
NP_441550.1_7 Reverse -147 -166 15.0377 0.252
NP_440206.1_10 Reverse -308 -327 13.6675 0.288
NP_439966.1_9 Reverse -92 -101 6.5879 0.253
NP_442941.1_3 Reverse -95 -105 5.28991 0.122
NP_440260.1_8 Forward -140 -122 -4.8974 0.273
NP_441514.1_4 Reverse -6 -25 12.9884 0.272
NP_442281.1_1 Reverse -382 -396 3.14559 0.243
NP_441644.1_6 Reverse -387 -397 5.38779 0.194
NP_442933.1_6 Reverse -141 -160 17.9043 0.123
NP_442933.1_6 Forward -82 -63 15.4215 0.237
NP_441751.2_8 Reverse -313 -327 -4.7203 0.179
NP_442554.1_8 Forward -102 -92 1.74999 0.298
NP_441865.1_3 Forward -27 -9 15.6538 0.225
NP_441468.1_1 Forward -102 -95 3.97235 0.277
NP_441020.2_6 Forward -140 -123 5.74204 0.291
NP_442490.1_9 Forward -124 -105 3.04771 0.165
NP_441764.1_8 Reverse -73 -83 12.9377 0.284
NP_441251.1_8 Forward -176 -163 11.2343 0.27
NP_440806.1_2 Forward -298 -279 11.2092 0.22
NP_442692.1_10 Reverse -379 -392 19.1212 0.155
NP_440334.1_1 Reverse -147 -166 15.8035 0.262
NP_440558.1_2 Forward -112 -93 -7.57203 0.296
NP_441036.1_7 Forward -266 -256 16.4991 0.159
NP_442579.1_4 Forward -202 -183 4.12936 0.29
NP_442183.1_1 Forward -321 -307 5.60446 0.21
NP_442645.1_2 Reverse -107 -126 -14.2585 0.172
NP_441037.1_4 Forward -126 -116 6.05075 0.283
NP_440151.1_5 Reverse -229 -248 9.3409 0.201
NP_440136.1_1 Reverse -243 -259 8.90762 0.283
NP_442998.1_5 Forward -261 -251 10.7964 0.204
NP_440299.1_1 Reverse -90 -103 7.68852 0.107
NP_440299.1_1 Reverse -111 -124 3.85363 0.228
NP_440299.1_6 Reverse -105 -124 15.9291 0.158
NP_440256.1_1 Forward -399 -380 0.0977854 0.087
NP_441957.1_1 Forward -111 -92 9.0459 0.175
NP_440709.1_1 Reverse -159 -178 6.09517 0.16
NP_441559.1_8 Reverse -246 -260 -5.9986 0.271
NP_440733.1_2 Reverse -8 -26 16.8086 0.105
NP_440717.1_3 Reverse -132 -146 6.88214 0.291
NP_440787.1_5 Reverse -10 -24 13.5693 0.256
NP_440677.1_1 Forward -133 -114 7.07928 0.243
NP_442386.1_9 Reverse -93 -102 11.4057 0.0942
NP_442386.1_9 Forward -104 -95 10.029 0.142
NP_442386.1_9 Reverse -386 -395 7.07914 0.219
NP_440570.1_5 Reverse -231 -250 5.70265 0.188
NP_441340.1_9 Forward -262 -252 8.15881 0.256
NP_441340.1_9 Forward -178 -168 7.19474 0.29
NP_439909.1_3 Reverse -183 -202 18.3429 0.146
NP_440168.1_4 Reverse -105 -124 -6.78538 0.26
NP_440211.1_7 Forward -118 -100 11.5239 0.105
NP_440192.1_4 Reverse -92 -111 8.62144 0.292
NP_442959.1_5 Forward -260 -241 7.27595 0.238
NP_442294.1_3 Forward -19 -5 13.077 0.274
NP_439943.1_1 Forward -124 -105 -6.29373 0.237
NP_442285.1_7 Reverse -110 -129 9.3409 0.274
NP_439977.1_5 Reverse -88 -107 3.93269 0.157
NP_442085.1_1 Reverse -143 -162 20.0051 0.0442
NP_441689.1_5 Forward -105 -95 5.28945 0.273
NP_441896.1_3 Forward -147 -128 0.58944 0.225
NP_440999.1_9 Reverse -308 -322 -2.85201 0.279
NP_442845.1_2 Forward -109 -95 10.816 0.142
NP_442710.1_7 Forward -185 -166 -1.64837 0.221
NP_441469.1_8 Reverse -93 -102 5.89959 0.246
NP_443062.1_1 Reverse -94 -112 3.37804 0.3
NP_441560.1_5 Forward -116 -97 13.5691 0.239
NP_442428.1_5 Forward -102 -95 10.6589 0.0727
NP_442428.1_8 Reverse -90 -109 -0.688862 0.274
NP_441052.1_2 Reverse -100 -110 1.06167 0.252
NP_442219.1_8 Forward -119 -100 9.71324 0.222
NP_441884.1_2 Reverse -144 -158 15.0039 0.248
NP_442086.1_4 Forward -61 -42 17.8792 0.209
NP_440314.1_9 Reverse -304 -323 -1.27885 0.127
NP_440296.1_6 Forward -166 -148 14.8032 0.283
NP_440296.1_6 Reverse -169 -187 12.7979 0.295
NP_440296.1_6 Reverse -160 -178 12.034 0.295
NP_442694.1_4 Forward -373 -364 11.7011 0.277
NP_443054.1_2 Forward -251 -237 0.687908 0.256
NP_441851.1_9 Forward -324 -305 7.07928 0.288
NP_441851.1_10 Reverse -93 -103 4.50326 0.266
NP_441982.1_6 Reverse -4 -13 10.671 0.295
NP_442689.1_8 Reverse -253 -270 -7.53264 0.292
NP_440396.1_10 Reverse -304 -320 13.7258 0.151
NP_440078.1_10 Forward -124 -105 2.45773 0.269
NP_442729.1_5 Reverse -120 -130 12.3697 0.235
NP_441432.1_9 Forward -160 -147 11.8949 0.221
NP_441333.1_1 Forward -157 -147 10.9226 0.29
NP_441945.1_10 Reverse -114 -133 8.75091 0.273
NP_441659.2_7 Forward -262 -243 17.9393 0.158
NP_441092.1_6 Forward -126 -107 7.96426 0.233
NP_440363.1_8 Forward -320 -301 10.6192 0.288
NP_439956.1_7 Reverse -229 -248 4.22769 0.257
NP_440010.1_4 Reverse -105 -124 -3.14789 0.294
NP_442900.1_1 Forward -339 -320 -6.1954 0.238
NP_442796.1_10 Reverse -109 -128 8.06259 0.268
NP_440671.1_1 Forward -89 -70 5.84395 0.26
NP_440671.1_4 Forward -109 -95 5.60446 0.279
NP_442140.1_3 Forward -102 -92 7.64985 0.133
NP_441609.1_5 Reverse -241 -260 8.35759 0.279
NP_440821.1_4 Reverse -92 -102 5.19158 0.117
NP_441239.1_9 Reverse -385 -397 8.9871 0.117
NP_441239.1_9 Reverse -92 -104 8.6921 0.125
NP_442568.1_8 Forward -187 -173 9.34103 0.257
NP_441698.1_1 Forward -189 -172 16.4368 0.273
NP_441617.1_6 Reverse -251 -270 -5.11376 0.274
NP_442402.1_10 Reverse -132 -142 11.091 0.269
NP_441848.1_4 Forward -303 -287 9.556 0.277
NP_441084.1_6 Reverse -107 -121 9.24716 0.29
NP_442039.1_7 Reverse -1 -11 6.96153 0.286
NP_442829.1_2 Forward -184 -168 7.85119 0.295
NP_442532.1_2 Reverse -8 -27 10.8379 0.121
NP_440914.1_1 Reverse -387 -397 9.98138 0.164
NP_442470.1_3 Reverse -305 -324 10.7167 0.22
NP_442541.1_10 Forward -250 -236 1.27731 0.287
NP_441482.1_7 Forward -144 -130 -11.3085 0.254
NP_441697.1_5 Reverse -166 -185 -0.334645 0.199
NP_441697.1_5 Reverse -150 -169 -10.8388 0.286
NP_441697.1_5 Forward -176 -157 -11.6027 0.297
NP_441028.1_6 Reverse -255 -265 4.7978 0.277
NP_440116.1_8 Reverse -95 -114 -6.58872 0.211
NP_441527.1_4 Forward -187 -168 -3.67686 0.171
NP_440007.1_9 Forward -107 -93 3.24451 0.272
NP_441347.1_9 Forward -87 -74 14.6565 0.153
NP_441961.1_4 Reverse -92 -111 10.9142 0.23
NP_440429.1_2 Forward -108 -89 9.53756 0.272
NP_440886.1_7 Reverse -311 -321 5.28945 0.188
NP_442401.1_3 Forward -140 -121 11.4058 0.296
NP_439899.1_1 Forward -181 -163 4.96602 0.251
NP_440907.2_8 Forward -102 -92 4.89613 0.235
NP_442893.1_4 Forward -168 -149 -0.197979 0.252
NP_442211.1_9 Reverse -127 -146 0.982764 0.291
NP_442365.1_7 Reverse -299 -318 1.57275 0.168
NP_442615.1_4 Reverse -87 -101 16.5192 0.174
NP_441962.1_4 Forward -108 -89 -11.8003 0.245
NP_442020.1_1 Forward -258 -239 -1.57461 0.291
NP_441836.1_1 Forward -332 -313 13.6421 0.223
NP_441174.1_2 Forward -106 -92 11.701 0.286
NP_440358.1_2 Reverse -311 -328 8.39624 0.294
NP_441425.1_2 Reverse -146 -165 16.2791 0.184
NP_441425.1_2 Forward -167 -148 11.8865 0.269
NP_442743.1_1 Reverse -377 -396 6.39016 0.268
NP_441801.1_4 Reverse -133 -143 2.53664 0.292
NP_441885.1_5 Forward -312 -302 -1.00328 0.248
NP_441428.1_8 Reverse -116 -135 4.22769 0.243
NP_442703.1_9 Forward -310 -292 6.01734 0.244
NP_441173.1_9 Forward -11 -3 12.1137 0.21
NP_441173.1_9 Reverse -383 -391 11.0321 0.228
NP_441207.1_7 Forward -187 -173 13.0311 0.229
NP_442116.1_6 Reverse -140 -157 5.2087 0.299
NP_441974.1_3 Reverse -121 -138 15.385 0.257
NP_440988.1_10 Reverse -98 -112 4.51157 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATAGGCCATTGGTGGAAGATTCAATAGGGCTTGTTTCAGAGACGAATCAGACATTGTACTAATTGGGTGTCAGGGCTAGGTGATTGAGGCTATTGTTAGCATCAAAAATAGTTCTTTGTAACTTACCAGAGAAGCTGAAGGAAAAATCCTGCCAAATCCACATCCCGGGCTAATTCGCATAATCATTCATAAGTTTCGAAATCATAGTAACTCAAAAAGACTATAAAAACTTGTAAATTATAAGTTTATTTTTAGAGCTGGGGAGATTTCACCTCGGCTACGGTCAGGGTTTCCATAGCGATGCCAGCAGAATGTTAAGTTTTATGTATAGATTTAACGTTACTGGTACGCAGGATAATGAAAGTAGAGTAGTTTAATTGCCTAGATTTTTAGCCAACG

CDS

ATGACCCATTCCCCTGAATCCAACCCTACTGTGAGCGCCGCCGAAGCCGCTGAACTGATCCGTTCCCTGTTGCATAAAGAGGGCACTTGGGTAGATTGGGGTAAAAAATGTCAGCAATTACAGAAGGCAGGTTACGGTGCTGAAGAAATTTTTGAGCAGTCCGGCTTCCAAAAAGTGCAACAAAATTTGGTGATTGTGGCTAGTCAAGTGTATGAAAGTCTGGTCAAGCAAGGCATCGATGAAACGGTACTATCCTATTATCGGGGTCCCAAAAGTGACGTGCTGTACGAACTACGCATCCTCAACCATCAACAACGGGCGATCGCCGCAGTGGAGGCCCAGCAGAAGAATTTGGCTGCCGATGAAGCGAAGGAATTGGCTAAGGCATTTCAGGAATTTGGTTACCTGTCCCAACTGCCAGAAGGTTTTACCGACCATCCTGGGGACGCATTGGCCTATCAATGTTGGAAATTAGCCCGGCAGAAAAAGAATTTGCCGGAAAGAACCCGTTTAATTGTCAAAGGATTAAAATTCGCCCATTCCCCCAACGCCCGTCAGGCGATCGAAAAATTACTGACTGATTTAACCGCCCAGCCTAGCCGGAAAGCTCCCTTAGTGCCGGTGTTTCGCCTCGAAGAAGACCAGGAAGCGGCCCGACTCATTCCAGTGGCGGGGACTTTTCCCCTCCAGCCCCAGGCGGTGCAGGCAGTGCAGTCTTTAGAACAGGTGGAACCTTTTGGTTTAGTTAGTTACCAAGGGGAAGGGGCGGTGGTGCCGGTGCCCCAGTGGCAAGCAATTTTGACCGCGGAAGATCCGGTGGCGATTTTTTGTCCGGCAGGGCAAGTGTCGGAATCCCTAGCCCGTAAGGATGAACAGGTTTTGGTGGTGGTGGATCGCAGCAAAAAAATTTGGAATGATGGCAGTTATTTTCTGCTCAACCAAGGAGAAACAGTAGCAATTCAATGGTGCGAAACAGAGCCAGAAAGGGAGATTTTAGCCCAGGTGGTGTTGGTGCTCCGACCGAAGAAGATTTTCGATGCCAACAACCTGCGGGAACCATGGCAAATGGATGATTAG

Protein

MTHSPESNPTVSAAEAAELIRSLLHKEGTWVDWGKKCQQLQKAGYGAEEIFEQSGFQKVQQNLVIVASQVYESLVKQGIDETVLSYYRGPKSDVLYELRILNHQQRAIAAVEAQQKNLAADEAKELAKAFQEFGYLSQLPEGFTDHPGDALAYQCWKLARQKKNLPERTRLIVKGLKFAHSPNARQAIEKLLTDLTAQPSRKAPLVPVFRLEEDQEAARLIPVAGTFPLQPQAVQAVQSLEQVEPFGLVSYQGEGAVVPVPQWQAILTAEDPVAIFCPAGQVSESLARKDEQVLVVVDRSKKIWNDGSYFLLNQGETVAIQWCETEPEREILAQVVLVLRPKKIFDANNLREPWQMDD