Your browser is old and dusty. Try Google Chrome!

Details for sll0101

ORF sll0101
Accession NP_442569.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -159 -173 10.816 0.057
NP_440795.1_7 Forward -166 -159 14.6904 0.0123
NP_440795.1_7 Reverse -159 -166 14.6904 0.0123
NP_442291.1_5 Forward -168 -152 6.45005 0.0694
NP_440897.1_6 Forward -167 -148 0.686995 0.179
NP_441453.1_4 Reverse -158 -166 16.539 0.00633
NP_441453.1_4 Forward -167 -159 16.539 0.00633
NP_441623.1_1 Forward -202 -184 -4.30741 0.274
NP_442151.1_6 Reverse -158 -172 14.6509 0.0321
NP_442151.1_6 Forward -167 -153 10.1277 0.13
NP_441818.1_1 Forward -166 -155 15.4961 0.0264
NP_440226.1_1 Forward -167 -148 8.75091 0.0823
NP_442173.1_1 Forward -166 -158 15.4574 0.00633
NP_442173.1_1 Reverse -159 -167 15.4574 0.00633
NP_442752.1_4 Forward -167 -160 13.8055 0.0199
NP_442752.1_4 Reverse -158 -165 13.8055 0.0199
NP_442752.1_4 Reverse -317 -324 5.25066 0.256
NP_443027.1_4 Reverse -156 -166 11.0914 0.107
NP_442975.1_10 Reverse -154 -168 3.34225 0.259
NP_442975.1_10 Forward -171 -157 1.37564 0.299
NP_440784.1_7 Forward -166 -159 15.9687 0.0123
NP_440784.1_7 Reverse -159 -166 15.9687 0.0123
NP_442909.1_7 Reverse -159 -173 10.5204 0.136
NP_440061.1_9 Forward -169 -155 18.3868 0.00917
NP_440061.1_9 Reverse -156 -170 10.422 0.124
NP_440878.1_4 Reverse -56 -74 11.9172 0.288
NP_442062.1_8 Forward -167 -157 17.3846 0.00193
NP_442062.1_8 Reverse -158 -168 17.3846 0.00193
NP_440304.1_4 Forward -169 -159 1.84832 0.299
NP_440304.1_4 Reverse -156 -166 1.84832 0.299
NP_442242.1_4 Forward -166 -159 14.3954 0.0124
NP_442242.1_4 Reverse -159 -166 14.3954 0.0124
NP_440044.1_8 Forward -166 -147 -0.39387 0.22
NP_439918.1_2 Forward -185 -166 1.17943 0.217
NP_439918.1_2 Forward -179 -160 -4.6221 0.281
NP_441352.1_4 Forward -125 -106 20.4523 0.101
NP_441619.1_8 Forward -173 -159 17.9935 0.061
NP_442726.1_1 Forward -172 -153 13.7658 0.147
NP_440856.1_4 Reverse -151 -170 -1.08219 0.191
NP_441083.1_5 Forward -167 -157 20.3345 0.00053
NP_441083.1_5 Reverse -158 -168 20.3345 0.00053
NP_441738.1_2 Forward -165 -158 15.28 0.0102
NP_441738.1_2 Reverse -160 -167 15.28 0.0102
NP_441558.1_5 Reverse -156 -175 3.73603 0.299
NP_440209.1_1 Reverse -158 -166 18.1123 0.00295
NP_440209.1_1 Forward -167 -159 18.1123 0.00295
NP_442889.1_1 Forward -254 -235 -14.3569 0.273
NP_442889.1_8 Reverse -155 -169 13.2736 0.0588
NP_440447.1_5 Reverse -272 -282 13.2547 0.291
NP_440447.1_6 Reverse -363 -381 0.510803 0.288
NP_442570.1_3 Forward -175 -156 -2.36049 0.212
NP_442111.1_4 Forward -168 -154 3.93283 0.226
NP_442111.1_4 Reverse -157 -171 1.76955 0.294
NP_441624.1_7 Reverse -371 -385 7.37441 0.257
NP_440906.1_5 Forward -166 -159 15.8704 0.0124
NP_440906.1_5 Reverse -159 -166 15.8704 0.0124
NP_440747.1_1 Reverse -335 -353 7.59063 0.251
NP_440747.1_10 Reverse -155 -167 16.7552 0.0019
NP_440747.1_10 Forward -170 -158 14.887 0.00223
NP_441486.1_1 Reverse -155 -169 6.3911 0.0344
NP_441486.1_1 Forward -170 -156 5.89945 0.0344
NP_441880.2_10 Reverse -103 -121 17.2271 0.111
NP_443018.1_3 Forward -166 -159 14.8871 0.0123
NP_443018.1_3 Reverse -159 -166 14.8871 0.0123
NP_441634.1_8 Reverse -156 -170 -3.147 0.295
NP_440376.1_1 Forward -167 -158 19.4693 0.000692
NP_440376.1_1 Reverse -158 -167 19.4693 0.000692
NP_441588.1_4 Reverse -160 -170 15.9097 0.0369
NP_441588.1_4 Forward -165 -155 6.46988 0.193
NP_442687.1_7 Forward -168 -158 8.92815 0.0994
NP_442687.1_7 Reverse -157 -167 8.92815 0.0994
NP_442687.1_7 Reverse -382 -392 3.91327 0.278
NP_442530.1_2 Forward -262 -252 11.5831 0.284
NP_441422.1_7 Reverse -156 -173 -3.5994 0.235
NP_440360.1_10 Reverse -160 -174 4.52282 0.227
NP_442658.1_1 Reverse -156 -166 7.94438 0.199
NP_442658.1_1 Forward -169 -159 6.76441 0.214
NP_442658.1_1 Forward -328 -318 5.48612 0.265
NP_442198.1_3 Reverse -149 -168 7.66927 0.249
NP_442782.1_2 Reverse -383 -397 1.37622 0.281
NP_442205.1_9 Forward -173 -157 -3.18639 0.28
NP_441414.1_9 Reverse -158 -177 5.89931 0.0437
NP_441414.1_9 Forward -167 -148 3.44104 0.0588
NP_441487.1_3 Forward -282 -263 11.3075 0.022
NP_442937.1_5 Reverse -153 -172 10.0292 0.173
NP_442937.1_5 Forward -172 -153 6.29264 0.282
NP_442321.1_4 Reverse -191 -210 -7.57203 0.284
NP_441958.1_5 Forward -168 -158 12.2714 0.00183
NP_441958.1_5 Reverse -157 -167 12.2714 0.00183
NP_441127.1_1 Forward -70 -56 12.4876 0.213
NP_440318.1_1 Reverse -268 -287 4.81767 0.235
NP_439905.1_1 Forward -166 -153 8.86907 0.228
NP_439905.1_1 Reverse -159 -172 8.86907 0.228
NP_440995.1_8 Forward -177 -158 0.0977854 0.284
NP_440984.1_7 Reverse -153 -167 17.6008 0.0235
NP_440984.1_7 Forward -172 -158 11.0127 0.122
NP_439990.1_5 Forward -172 -159 7.6891 0.186
NP_442376.1_8 Forward -397 -383 15.6342 0.124
NP_442911.1_2 Forward -177 -158 -3.83545 0.119
NP_442911.1_2 Reverse -148 -167 -11.1119 0.299
NP_440153.1_5 Forward -166 -152 2.45787 0.223
NP_440993.1_3 Reverse -148 -167 2.35861 0.208
NP_440138.1_6 Reverse -159 -178 6.68515 0.22
NP_441913.1_3 Reverse -244 -257 16.4864 0.218
NP_440809.1_9 Reverse -149 -167 -8.04399 0.225
NP_441646.1_1 Forward -174 -155 5.211 0.182
NP_441000.1_6 Forward -168 -154 -3.73699 0.225
NP_440484.1_3 Reverse -156 -170 11.2093 0.242
NP_440147.1_4 Forward -169 -156 18.9972 0.00328
NP_440147.1_4 Reverse -156 -169 8.77074 0.0465
NP_441550.1_8 Reverse -156 -166 15.1225 0.0132
NP_441550.1_8 Forward -169 -159 14.6309 0.0132
NP_441916.1_7 Forward -167 -157 10.3048 0.0261
NP_441916.1_7 Reverse -158 -168 10.3048 0.0261
NP_442396.1_5 Forward -171 -158 21.1604 0.00421
NP_442004.1_6 Reverse -158 -172 7.66941 0.157
NP_442004.1_6 Reverse -238 -252 2.06454 0.274
NP_441725.1_5 Forward -166 -156 2.04498 0.115
NP_441725.1_5 Reverse -159 -169 2.04498 0.115
NP_439966.1_7 Reverse -156 -166 15.3192 0.0152
NP_439966.1_7 Forward -169 -159 7.25606 0.15
NP_442941.1_3 Forward -166 -156 19.2529 0.00262
NP_442941.1_3 Reverse -159 -169 11.0914 0.0116
NP_440289.1_2 Reverse -155 -168 3.06754 0.0811
NP_440289.1_2 Forward -170 -157 -4.9956 0.294
NP_440260.1_7 Forward -200 -181 0.58944 0.241
NP_440260.1_8 Forward -176 -158 -6.96235 0.295
NP_442281.1_1 Reverse -153 -167 8.16044 0.0845
NP_442281.1_1 Forward -172 -158 6.98048 0.111
NP_440177.1_9 Forward -175 -156 13.5691 0.226
NP_442256.1_2 Reverse -156 -174 -9.22396 0.254
NP_441644.1_6 Forward -167 -157 17.3841 0.00127
NP_441644.1_6 Reverse -158 -168 17.3841 0.00127
NP_442215.1_2 Forward -169 -153 -1.12144 0.179
NP_442215.1_2 Reverse -156 -172 -4.95634 0.242
NP_440253.1_2 Forward -167 -149 3.3624 0.118
NP_440929.1_8 Forward -167 -158 19.2726 0.000701
NP_440929.1_8 Reverse -158 -167 19.2726 0.000701
NP_440566.1_2 Forward -390 -371 6.39097 0.265
NP_442933.1_10 Forward -167 -158 17.601 0.00325
NP_442933.1_10 Reverse -158 -167 17.601 0.00325
NP_441751.2_8 Reverse -159 -173 5.30946 0.0448
NP_442554.1_8 Forward -166 -156 16.2046 0.0065
NP_442554.1_8 Reverse -159 -169 15.3197 0.00882
NP_441762.1_7 Reverse -157 -169 0.432302 0.0747
NP_441762.1_7 Forward -168 -156 -6.74586 0.284
NP_442142.1_4 Reverse -155 -168 4.24695 0.227
NP_442142.1_4 Forward -170 -157 2.96866 0.269
NP_442292.1_1 Forward -166 -157 18.486 0.00229
NP_442292.1_1 Reverse -159 -168 18.486 0.00229
NP_441525.1_1 Reverse -86 -99 14.0806 0.231
NP_442476.1_6 Forward -166 -152 11.8976 0.0525
NP_442476.1_6 Reverse -159 -173 2.85119 0.171
NP_440895.1_6 Forward -173 -160 10.7374 0.202
NP_443009.1_5 Reverse -157 -168 8.90795 0.0965
NP_443009.1_5 Forward -168 -157 8.90795 0.0965
NP_443009.1_5 Reverse -336 -347 4.08976 0.263
NP_443009.1_5 Reverse -89 -100 3.49977 0.292
NP_441715.1_4 Forward -166 -156 17.3846 0.0106
NP_441715.1_4 Reverse -159 -169 7.94484 0.107
NP_440015.1_9 Reverse -158 -176 2.57575 0.204
NP_440464.1_10 Reverse -159 -169 13.0082 0.169
NP_441468.1_1 Forward -166 -159 15.8704 0.0124
NP_441468.1_1 Reverse -159 -166 15.8704 0.0124
NP_441015.1_10 Forward -172 -153 -4.72043 0.211
NP_441673.1_1 Forward -167 -158 20.8459 0.000698
NP_441673.1_1 Reverse -158 -167 20.8459 0.000698
NP_440286.1_2 Forward -112 -99 16.7355 0.26
NP_441876.1_9 Reverse -270 -280 12.0743 0.267
NP_441330.1_1 Reverse -153 -172 7.27595 0.0252
NP_442490.1_9 Forward -179 -160 -8.45701 0.291
NP_442868.1_6 Reverse -156 -166 19.2529 0.00563
NP_442868.1_6 Forward -169 -159 9.81313 0.038
NP_442868.1_6 Reverse -88 -98 2.14332 0.205
NP_442719.1_2 Reverse -52 -70 0.411736 0.162
NP_442719.1_2 Reverse -377 -395 -1.9482 0.181
NP_442719.1_2 Forward -67 -49 -11.5846 0.292
NP_441612.1_2 Reverse -158 -168 8.54929 0.21
NP_441612.1_2 Forward -167 -157 8.54929 0.21
NP_442427.1_8 Reverse -149 -168 11.1109 0.155
NP_442808.1_1 Reverse -157 -167 8.63269 0.0481
NP_442808.1_1 Forward -168 -158 8.63269 0.0481
NP_442505.1_2 Reverse -105 -124 18.6308 0.132
NP_442050.1_5 Reverse -156 -166 14.3359 0.0206
NP_442050.1_5 Forward -169 -159 7.64939 0.243
NP_441114.1_3 Forward -325 -316 6.39124 0.277
NP_441878.1_6 Forward -168 -158 10.4031 0.0176
NP_441878.1_6 Reverse -157 -167 10.4031 0.0176
NP_441036.1_3 Forward -288 -269 -3.93378 0.266
NP_441036.1_8 Forward -168 -158 8.33817 0.174
NP_441036.1_8 Reverse -157 -167 8.33817 0.174
NP_441557.1_5 Forward -167 -158 19.9609 0.000699
NP_441557.1_5 Reverse -158 -167 19.9609 0.000699
NP_441445.1_1 Forward -176 -157 7.96426 0.124
NP_441445.1_1 Reverse -149 -168 2.16274 0.24
NP_442066.2_9 Forward -171 -158 11.1307 0.154
NP_442066.2_9 Reverse -154 -167 10.639 0.154
NP_441433.1_8 Forward -288 -269 -2.0655 0.265
NP_440738.1_6 Forward -272 -253 18.0924 0.0631
NP_441458.1_10 Forward -176 -157 12.2908 0.091
NP_442183.1_1 Reverse -158 -172 9.2427 0.0999
NP_441574.1_1 Forward -179 -160 5.80098 0.12
NP_442347.1_2 Forward -166 -157 12.4878 0.056
NP_442347.1_2 Reverse -159 -168 12.4878 0.056
NP_442645.1_2 Forward -175 -156 -14.9469 0.185
NP_442645.1_2 Reverse -150 -169 -21.9284 0.29
NP_441037.1_4 Forward -169 -159 7.9999 0.237
NP_441633.1_3 Reverse -156 -169 3.46087 0.0699
NP_441633.1_3 Forward -169 -156 1.19926 0.109
NP_440136.1_2 Forward -166 -159 15.9687 0.0123
NP_440136.1_2 Reverse -159 -166 15.9687 0.0123
NP_442998.1_5 Forward -333 -323 8.82982 0.261
NP_442998.1_10 Forward -165 -158 15.5754 0.0102
NP_442998.1_10 Reverse -160 -167 15.5754 0.0102
NP_442998.1_10 Reverse -63 -70 7.21728 0.144
NP_440299.1_1 Forward -171 -158 12.9984 0.0319
NP_440299.1_1 Reverse -154 -167 11.0318 0.0529
NP_441799.1_1 Forward -171 -157 15.8302 0.0163
NP_441799.1_1 Reverse -154 -168 11.307 0.0591
NP_441007.1_10 Forward -172 -159 10.5407 0.0656
NP_441007.1_10 Reverse -153 -166 -0.865694 0.295
NP_442334.1_1 Forward -207 -188 -2.65548 0.186
NP_442201.1_10 Forward -178 -159 -11.7019 0.268
NP_442201.1_10 Reverse -147 -166 -14.2585 0.28
NP_440256.1_1 Forward -170 -151 4.22769 0.0459
NP_441559.1_8 Forward -397 -383 0.0979218 0.17
NP_441559.1_8 Reverse -382 -396 -1.8687 0.186
NP_441559.1_8 Reverse -273 -287 -3.34366 0.201
NP_441559.1_8 Reverse -332 -346 -5.70361 0.27
NP_440915.1_6 Reverse -154 -168 0.786239 0.153
NP_440997.1_6 Reverse -81 -100 13.6675 0.176
NP_442855.1_3 Forward -176 -157 14.1591 0.21
NP_441464.1_8 Reverse -158 -172 5.21113 0.26
NP_440695.1_5 Forward -167 -148 -2.16383 0.296
NP_442993.1_1 Reverse -158 -174 -10.4629 0.22
NP_442386.1_9 Reverse -157 -166 13.8639 0.0289
NP_442386.1_9 Forward -168 -159 13.8639 0.0289
NP_441340.1_5 Forward -166 -159 15.6737 0.0124
NP_441340.1_5 Reverse -159 -166 15.6737 0.0124
NP_440586.1_8 Forward -166 -159 13.2151 0.026
NP_440586.1_8 Reverse -159 -166 13.2151 0.026
NP_440586.1_8 Forward -395 -388 5.93863 0.283
NP_442251.1_6 Forward -166 -159 15.2804 0.0124
NP_442251.1_6 Reverse -159 -166 15.2804 0.0124
NP_442959.1_5 Reverse -41 -60 6.09597 0.262
NP_440684.1_9 Forward -173 -159 19.4691 0.0271
NP_441262.1_3 Reverse -158 -165 14.7888 0.0223
NP_441262.1_3 Forward -167 -160 14.7888 0.0223
NP_443051.1_1 Reverse -157 -166 10.4228 0.00754
NP_443051.1_1 Forward -168 -159 10.4228 0.00754
NP_439984.1_3 Forward -174 -160 15.8302 0.139
NP_440836.1_6 Reverse -264 -278 8.84938 0.263
NP_439943.1_1 Reverse -279 -298 -7.96535 0.263
NP_440372.1_2 Forward -166 -159 16.3621 0.0124
NP_440372.1_2 Reverse -159 -166 16.3621 0.0124
NP_441803.1_2 Forward -92 -73 -1.08219 0.294
NP_440139.1_1 Reverse -152 -171 4.12856 0.19
NP_442384.1_10 Reverse -158 -171 15.8506 0.00946
NP_442384.1_10 Forward -167 -154 12.2123 0.0296
NP_441877.1_7 Reverse -153 -172 0.195343 0.271
NP_441018.1_7 Forward -177 -158 7.27595 0.273
NP_442790.1_4 Forward -176 -157 -2.45882 0.115
NP_442262.1_10 Forward -166 -159 14.1988 0.0123
NP_442262.1_10 Reverse -159 -166 14.1988 0.0123
NP_441689.1_5 Forward -169 -159 5.78111 0.197
NP_441689.1_5 Reverse -156 -166 5.78111 0.197
NP_440163.1_10 Forward -102 -92 12.0747 0.169
NP_440344.1_10 Forward -174 -157 -8.12263 0.123
NP_440344.1_10 Forward -106 -89 -9.79426 0.156
NP_440531.1_6 Forward -175 -156 -5.50708 0.299
NP_440531.1_8 Forward -113 -94 6.29264 0.243
NP_441965.1_10 Reverse -155 -171 12.0549 0.107
NP_442693.1_7 Reverse -157 -176 10.7175 0.227
NP_442556.1_10 Reverse -257 -276 11.4091 0.229
NP_440297.1_1 Forward -292 -273 10.1275 0.196
NP_440297.1_9 Forward -166 -156 -0.118297 0.282
NP_440297.1_9 Reverse -159 -169 -0.118297 0.282
NP_441592.1_4 Reverse -158 -177 -0.983855 0.247
NP_442378.1_2 Forward -372 -353 17.7974 0.0756
NP_440888.1_2 Forward -167 -153 17.7968 0.00308
NP_440888.1_2 Reverse -158 -172 7.96378 0.175
NP_440600.1_4 Forward -175 -157 6.80398 0.097
NP_440600.1_4 Reverse -150 -168 -1.45582 0.166
NP_440052.1_5 Reverse -106 -125 -1.86883 0.205
NP_440052.1_5 Reverse -147 -166 -4.72043 0.265
NP_442033.1_7 Reverse -142 -161 15.8859 0.284
NP_441543.1_2 Forward -166 -157 16.9127 0.00359
NP_441543.1_2 Reverse -159 -168 16.9127 0.00359
NP_442845.1_2 Forward -173 -159 18.7808 0.0608
NP_442845.1_2 Reverse -152 -166 4.91614 0.249
NP_441469.1_8 Forward -168 -159 6.48957 0.227
NP_441469.1_8 Reverse -157 -166 6.48957 0.227
NP_443064.1_6 Forward -167 -157 12.5669 0.0796
NP_443064.1_6 Reverse -158 -168 12.5669 0.0796
NP_443064.1_6 Forward -274 -264 11.6943 0.124
NP_442578.1_7 Forward -166 -159 14.5921 0.026
NP_442578.1_7 Reverse -159 -166 14.5921 0.026
NP_441462.1_2 Forward -167 -157 11.5831 0.00406
NP_441462.1_2 Reverse -158 -168 11.5831 0.00406
NP_443062.1_1 Forward -167 -149 10.9836 0.106
NP_442204.1_5 Forward -177 -158 0.491109 0.261
NP_440516.1_8 Forward -167 -158 16.9127 0.00442
NP_440516.1_8 Reverse -158 -167 16.9127 0.00442
NP_442428.1_5 Forward -166 -159 15.8704 0.0124
NP_442428.1_5 Reverse -159 -166 15.8704 0.0124
NP_442120.1_10 Forward -117 -98 -1.57384 0.171
NP_440673.1_3 Forward -165 -158 12.4288 0.0426
NP_440673.1_3 Reverse -160 -167 12.4288 0.0426
NP_441052.1_2 Forward -167 -157 19.9412 0.00106
NP_441052.1_2 Reverse -158 -168 19.9412 0.00106
NP_442219.1_9 Forward -166 -157 17.7976 0.00718
NP_442219.1_9 Reverse -159 -168 17.7976 0.00718
NP_440436.1_4 Forward -166 -157 17.2072 0.00233
NP_440436.1_4 Reverse -159 -168 17.2072 0.00233
NP_440436.1_4 Forward -246 -237 6.78414 0.147
NP_440436.1_4 Forward -139 -130 5.80084 0.182
NP_441884.1_9 Forward -114 -95 -21.1417 0.229
NP_442086.1_3 Forward -166 -147 9.3409 0.224
NP_441893.1_10 Reverse -116 -135 9.73422 0.275
NP_440314.1_9 Forward -166 -147 -7.96535 0.243
NP_440314.1_9 Reverse -159 -178 -8.26035 0.246
NP_442414.1_9 Reverse -96 -115 11.7008 0.282
NP_441086.1_3 Forward -311 -292 5.07931 0.29
NP_441086.1_6 Forward -385 -375 17.0891 0.141
NP_441719.1_2 Forward -183 -169 12.8678 0.296
NP_441719.1_4 Forward -166 -159 16.3621 0.0124
NP_441719.1_4 Reverse -159 -166 16.3621 0.0124
NP_441004.1_1 Reverse -378 -397 -14.1602 0.265
NP_441004.1_1 Forward -173 -154 -17.8968 0.295
NP_442366.1_5 Forward -170 -160 15.4175 0.0374
NP_440296.1_10 Reverse -128 -147 -8.55534 0.253
NP_442312.1_1 Reverse -306 -325 10.6192 0.275
NP_443054.1_2 Reverse -156 -170 -0.393733 0.294
NP_441851.1_10 Forward -168 -158 15.8113 0.00552
NP_441851.1_10 Reverse -157 -167 15.8113 0.00552
NP_442208.1_5 Forward -290 -271 -5.99873 0.266
NP_440495.1_1 Forward -131 -112 7.66927 0.198
NP_441542.1_4 Reverse -55 -69 12.586 0.239
NP_441501.1_3 Forward -98 -79 19.9606 0.233
NP_442011.1_1 Reverse -157 -176 -1.47551 0.268
NP_441668.1_4 Forward -177 -158 -1.96717 0.285
NP_442515.1_1 Forward -168 -154 19.0758 0.0192
NP_442515.1_1 Reverse -157 -171 13.3726 0.0278
NP_442515.1_1 Reverse -86 -100 2.85119 0.129
NP_440593.1_3 Reverse -153 -172 -2.65548 0.227
NP_440463.1_8 Forward -100 -81 7.98396 0.264
NP_441349.1_10 Reverse -148 -167 2.3594 0.075
NP_441349.1_10 Forward -177 -158 -6.09707 0.221
NP_440432.1_9 Forward -166 -151 4.79811 0.0644
NP_442944.1_9 Reverse -149 -168 15.6341 0.261
NP_440431.1_3 Forward -168 -149 -5.99873 0.188
NP_442450.1_5 Forward -169 -159 7.55152 0.13
NP_441031.1_10 Forward -258 -239 15.2101 0.262
NP_442006.1_2 Reverse -341 -358 -17.5624 0.279
NP_440483.1_1 Forward -385 -366 -8.85033 0.297
NP_442243.1_1 Reverse -152 -170 5.52492 0.18
NP_441078.1_4 Forward -167 -158 19.6659 0.0007
NP_441078.1_4 Reverse -158 -167 19.6659 0.0007
NP_442729.1_8 Forward -171 -158 10.639 0.125
NP_441663.1_8 Reverse -329 -348 -0.0988766 0.227
NP_442443.1_1 Reverse -329 -348 -5.01543 0.28
NP_440526.1_3 Forward -139 -128 6.94134 0.172
NP_440526.1_3 Forward -166 -155 1.04151 0.267
NP_440526.1_3 Reverse -159 -170 1.04151 0.267
NP_441432.1_8 Reverse -157 -166 16.8143 0.00595
NP_441432.1_8 Forward -168 -159 16.8143 0.00595
NP_442320.1_8 Reverse -152 -166 13.4709 0.0144
NP_442320.1_8 Forward -173 -159 -2.55701 0.0913
NP_442344.1_7 Reverse -159 -178 -6.49039 0.171
NP_442344.1_7 Forward -166 -147 -6.98204 0.176
NP_441732.1_2 Forward -171 -155 -16.6577 0.186
NP_440629.1_1 Forward -314 -296 0.707465 0.277
NP_440760.1_1 Reverse -158 -177 -3.73712 0.0357
NP_442624.1_3 Reverse -57 -71 15.1426 0.286
NP_442353.1_4 Reverse -152 -171 0.0970122 0.281
NP_442727.1_10 Forward -65 -46 2.45773 0.203
NP_441072.1_2 Forward -178 -159 6.29264 0.283
NP_442489.1_7 Forward -167 -158 20.1576 0.000695
NP_442489.1_7 Reverse -158 -167 20.1576 0.000695
NP_440559.1_1 Forward -166 -157 17.4043 0.00658
NP_440559.1_1 Reverse -159 -168 17.4043 0.00658
NP_441659.2_8 Forward -167 -157 18.1713 0.00133
NP_441659.2_8 Reverse -158 -168 18.1713 0.00133
NP_441092.1_3 Reverse -160 -179 1.76941 0.192
NP_442913.1_9 Forward -173 -154 6.09597 0.297
NP_442913.1_10 Reverse -149 -168 -3.63879 0.214
NP_442346.1_2 Forward -178 -159 3.93269 0.293
NP_442346.1_5 Forward -168 -158 16.6963 0.00248
NP_442346.1_5 Reverse -157 -167 16.6963 0.00248
NP_442346.1_5 Forward -397 -387 4.3066 0.291
NP_441653.1_2 Reverse -147 -166 5.07576 0.248
NP_440010.1_4 Reverse -80 -99 1.96529 0.227
NP_440010.1_4 Reverse -154 -173 -1.18128 0.267
NP_442311.1_5 Forward -73 -54 4.22769 0.245
NP_442603.1_7 Forward -167 -153 11.1104 0.122
NP_440449.1_6 Reverse -257 -275 11.0765 0.14
NP_440170.1_5 Forward -177 -158 5.11266 0.216
NP_441833.1_4 Forward -166 -159 15.9687 0.0124
NP_441833.1_4 Reverse -159 -166 15.9687 0.0124
NP_442162.1_9 Forward -166 -159 16.2637 0.0124
NP_442162.1_9 Reverse -159 -166 16.2637 0.0124
NP_440224.1_1 Reverse -147 -166 2.94938 0.132
NP_442199.1_5 Reverse -150 -169 7.47261 0.0719
NP_442140.1_3 Reverse -159 -169 12.2714 0.0632
NP_442140.1_3 Forward -166 -156 10.3048 0.0902
NP_441813.1_3 Forward -288 -269 12.9769 0.296
NP_441813.1_5 Reverse -156 -166 18.1713 0.00743
NP_441813.1_5 Forward -169 -159 8.63316 0.0367
NP_440594.1_8 Reverse -49 -62 9.16348 0.193
NP_440590.1_4 Forward -166 -153 9.65572 0.0341
NP_440590.1_4 Reverse -159 -172 7.88576 0.0493
NP_440590.1_7 Forward -176 -162 15.4376 0.253
NP_440567.1_1 Reverse -159 -173 11.701 0.0272
NP_440567.1_1 Forward -166 -152 0.687908 0.236
NP_442497.1_10 Forward -166 -157 10.4228 0.0087
NP_442497.1_10 Reverse -159 -168 10.4228 0.0087
NP_440821.1_4 Reverse -156 -166 9.41981 0.0286
NP_440821.1_4 Forward -169 -159 9.41981 0.0286
NP_441239.1_9 Reverse -156 -168 5.25052 0.223
NP_441239.1_9 Forward -169 -157 3.38223 0.285
NP_441727.1_3 Forward -174 -155 6.29264 0.244
NP_440400.1_1 Forward -218 -199 -2.75457 0.287
NP_441892.1_1 Forward -176 -159 -1.14113 0.198
NP_441541.1_1 Forward -313 -295 -4.19966 0.272
NP_440546.1_4 Forward -167 -157 10.046 0.109
NP_440546.1_4 Reverse -158 -168 10.046 0.109
NP_440546.1_4 Reverse -238 -248 9.3673 0.142
NP_440546.1_4 Forward -380 -370 9.3673 0.142
NP_440546.1_4 Reverse -317 -327 7.52511 0.235
NP_441230.1_5 Reverse -153 -172 0.884433 0.258
NP_440462.1_6 Reverse -156 -166 9.61647 0.0429
NP_440462.1_6 Forward -169 -159 1.35667 0.294
NP_440868.1_4 Forward -171 -159 8.10212 0.0602
NP_440868.1_4 Reverse -154 -166 7.70879 0.0648
NP_441204.1_1 Reverse -149 -168 5.99764 0.278
NP_442479.1_9 Reverse -50 -69 -3.44213 0.241
NP_442479.1_9 Reverse -131 -150 -7.67036 0.266
NP_442402.1_4 Reverse -329 -348 -6.98278 0.268
NP_442402.1_4 Reverse -381 -400 -8.55607 0.283
NP_442402.1_6 Forward -280 -271 13.1761 0.289
NP_442402.1_10 Reverse -269 -279 14.0409 0.182
NP_441848.1_4 Reverse -376 -392 7.07321 0.297
NP_442039.1_4 Forward -166 -159 15.1821 0.0124
NP_442039.1_4 Reverse -159 -166 15.1821 0.0124
NP_442039.1_7 Reverse -389 -399 7.05986 0.283
NP_441811.1_8 Forward -173 -159 15.2409 0.162
NP_440825.1_7 Reverse -159 -169 12.9096 0.152
NP_442837.1_3 Forward -166 -159 15.7721 0.0124
NP_442837.1_3 Reverse -159 -166 15.7721 0.0124
NP_442053.1_1 Forward -167 -158 18.3876 0.0007
NP_442053.1_1 Reverse -158 -167 18.3876 0.0007
NP_440505.1_3 Reverse -156 -166 18.3679 0.00213
NP_440505.1_3 Forward -169 -159 9.22315 0.122
NP_440505.1_3 Reverse -315 -325 6.96153 0.169
NP_440505.1_3 Forward -101 -91 5.68323 0.217
NP_441252.1_6 Reverse -136 -143 11.6422 0.288
NP_440914.1_1 Forward -167 -157 17.5935 0.000537
NP_440914.1_1 Reverse -158 -168 17.5935 0.000537
NP_440914.1_1 Forward -326 -316 13.0067 0.0398
NP_441011.1_8 Forward -166 -157 8.25953 0.144
NP_441011.1_8 Reverse -159 -168 8.25953 0.144
NP_442533.1_1 Forward -292 -273 -10.6203 0.235
NP_442533.1_6 Forward -167 -158 17.2076 0.00137
NP_442533.1_6 Reverse -158 -167 17.2076 0.00137
NP_442232.1_3 Forward -175 -156 -13.3736 0.282
NP_441482.1_7 Forward -173 -159 -10.7185 0.213
NP_441482.1_7 Reverse -152 -166 -12.2918 0.292
NP_439944.1_9 Forward -166 -156 10.5014 0.0887
NP_439944.1_9 Reverse -159 -169 10.5014 0.0887
NP_442269.1_10 Forward -197 -178 2.85105 0.264
NP_441028.1_6 Reverse -366 -376 8.04271 0.217
NP_441028.1_6 Forward -225 -215 4.60114 0.278
NP_441028.1_6 Reverse -269 -279 3.8145 0.281
NP_442202.1_6 Forward -68 -49 0.786102 0.265
NP_440116.1_8 Forward -166 -147 -5.70374 0.194
NP_440115.1_6 Reverse -155 -165 6.76487 0.167
NP_441106.1_1 Forward -168 -159 9.63616 0.0311
NP_441106.1_1 Reverse -157 -166 9.63616 0.0311
NP_439903.1_6 Reverse -155 -174 6.98015 0.164
NP_439903.1_6 Reverse -167 -186 -1.18128 0.293
NP_441286.1_1 Forward -168 -156 12.9203 0.00815
NP_441286.1_1 Reverse -157 -169 12.9203 0.00815
NP_442674.1_3 Forward -175 -156 4.03023 0.294
NP_440670.1_8 Forward -167 -158 18.3876 0.000699
NP_440670.1_8 Reverse -158 -167 18.3876 0.000699
NP_441705.1_3 Forward -291 -272 5.80098 0.21
NP_440886.1_7 Forward -168 -158 7.94438 0.0805
NP_440886.1_7 Reverse -157 -167 7.94438 0.0805
NP_440828.1_1 Forward -357 -338 0.195343 0.269
NP_442614.1_2 Reverse -158 -172 7.07942 0.275
NP_440513.1_3 Forward -74 -57 18.0447 0.271
NP_440907.2_8 Reverse -159 -169 7.64939 0.117
NP_442264.1_2 Forward -177 -160 5.05372 0.287
NP_440841.1_4 Forward -169 -150 3.6377 0.0964
NP_440841.1_4 Reverse -156 -175 -8.35868 0.25
NP_441463.1_3 Reverse -148 -167 9.93088 0.0481
NP_441463.1_3 Forward -147 -128 -8.55534 0.271
NP_441463.1_3 Forward -177 -158 -10.4236 0.294
NP_442842.1_6 Forward -125 -106 11.0125 0.294
NP_441626.1_2 Forward -166 -159 15.7721 0.0124
NP_441626.1_2 Reverse -159 -166 15.7721 0.0124
NP_442362.1_1 Forward -250 -231 26.7455 0.00299
NP_442794.1_1 Forward -171 -159 9.28209 0.0795
NP_442794.1_1 Reverse -154 -166 7.4138 0.138
NP_442615.1_1 Reverse -149 -167 13.9821 0.0109
NP_442615.1_1 Forward -176 -158 7.4923 0.0317
NP_441962.1_4 Forward -97 -78 -10.7186 0.232
NP_440387.1_1 Reverse -158 -174 13.1366 0.00945
NP_440855.1_5 Forward -175 -156 3.04693 0.287
NP_440855.1_5 Reverse -156 -175 2.75194 0.288
NP_441836.1_2 Reverse -381 -400 10.4225 0.0879
NP_441836.1_2 Forward -173 -154 1.17943 0.197
NP_441993.1_1 Reverse -195 -214 11.3026 0.115
NP_441993.1_1 Forward -173 -154 10.7178 0.123
NP_441174.1_4 Forward -376 -366 16.6963 0.23
NP_440114.1_10 Reverse -158 -172 7.37441 0.236
NP_440114.1_10 Forward -167 -153 6.6861 0.26
NP_441272.1_7 Forward -173 -163 13.943 0.257
NP_441237.1_9 Reverse -159 -169 14.828 0.0242
NP_439910.1_2 Reverse -150 -167 -22.3806 0.232
NP_440457.1_1 Reverse -154 -166 -0.649339 0.271
NP_442940.1_2 Reverse -158 -177 7.47261 0.18
NP_441801.1_4 Reverse -270 -280 2.83163 0.231
NP_441436.1_8 Reverse -316 -335 10.3242 0.262
NP_442509.1_6 Forward -290 -271 6.4893 0.294
NP_442509.1_9 Forward -167 -157 8.14104 0.192
NP_442509.1_9 Reverse -158 -168 8.14104 0.192
NP_442514.1_5 Forward -249 -230 -9.53937 0.296
NP_440554.1_4 Forward -166 -156 8.92815 0.0646
NP_442862.1_3 Forward -184 -167 6.23369 0.267
NP_442862.1_3 Reverse -51 -68 5.84037 0.267
NP_441885.1_5 Forward -167 -157 20.9245 0.000538
NP_441885.1_5 Reverse -158 -168 20.9245 0.000538
NP_440478.1_4 Forward -171 -152 11.0125 0.264
NP_440478.1_10 Forward -169 -155 8.65272 0.257
NP_442703.1_4 Reverse -158 -177 0.490334 0.298
NP_442341.1_7 Reverse -157 -171 13.6676 0.0334
NP_442341.1_7 Forward -275 -261 2.16287 0.267
NP_441173.1_9 Reverse -55 -63 13.2937 0.17
NP_441173.1_9 Reverse -270 -278 12.0154 0.214
NP_442395.2_9 Forward -273 -257 12.3499 0.279
NP_440423.1_6 Forward -175 -156 -15.9302 0.229
NP_443000.1_7 Reverse -156 -166 19.9412 0.00223
NP_443000.1_7 Forward -169 -159 10.3048 0.0345
NP_440275.1_3 Reverse -156 -166 15.123 0.0182
NP_440275.1_3 Forward -169 -159 8.04317 0.0602
NP_440091.1_1 Reverse -154 -166 -0.452677 0.273
NP_443060.1_2 Reverse -148 -167 3.04771 0.21
NP_441902.1_3 Forward -117 -107 11.6212 0.293
NP_443010.1_10 Forward -102 -85 4.31693 0.234
NP_441105.1_3 Forward -178 -159 6.29264 0.062
NP_441105.1_3 Reverse -147 -166 1.17943 0.117
NP_441105.1_3 Reverse -227 -246 -8.06369 0.265
NP_440216.1_1 Forward -167 -153 16.8142 0.00213
NP_440216.1_1 Reverse -158 -172 -10.6202 0.145
NP_440172.1_1 Forward -167 -157 15.0247 0.00945
NP_440172.1_1 Reverse -158 -168 15.0247 0.00945
NP_442371.1_1 Forward -279 -269 12.4676 0.249
NP_442015.1_10 Reverse -154 -167 2.77255 0.187
NP_442015.1_10 Forward -171 -158 1.39592 0.204
NP_441226.1_7 Forward -166 -159 14.4934 0.0123
NP_441226.1_7 Reverse -159 -166 14.4934 0.0123
NP_441111.1_7 Forward -166 -158 18.7023 0.00294
NP_441111.1_7 Reverse -159 -167 18.7023 0.00294
NP_441766.1_2 Forward -167 -158 17.5026 0.00297
NP_441766.1_2 Reverse -158 -167 17.5026 0.00297
NP_440416.1_9 Forward -174 -155 -15.3402 0.189
NP_440416.1_9 Reverse -376 -395 -20.4534 0.285
NP_443052.1_8 Reverse -148 -167 -8.16202 0.169
NP_443052.1_9 Forward -245 -226 -4.03212 0.254
NP_442116.1_6 Reverse -294 -311 5.39969 0.299
NP_440885.1_6 Forward -71 -52 9.71588 0.212
NP_440261.1_5 Forward -166 -153 -2.63565 0.0924
NP_440261.1_5 Reverse -159 -172 -10.3055 0.201
NP_440988.1_2 Forward -212 -194 8.27895 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTGGCCAACGTTTGCCAAACCTATGGGGCGAAATATGAAGTCAATTACCGTCGGGGAGTACCTTCGGTACAGAACGATGCCCAGTTAAATAAGTTGTTAGAAAATGCAGTGCGGGAAGCCTGGGGAGAATCAGCCCTGCAAATTATTCCTGAACCATCCCTAGGGGCAGAAGATTTTGCTCTATACCTAGAACACGCCCCTGGAGCTATGTTTCGTTTAGGTACTGGTTTTGGCGATCGCCAGATGAATCATCCTTTGCACCATCCTCGCTTTGAAGCCGATGAAGCAGCAATTTTAACGGGGGTTGTCACCCTCAGCTATGCTGCCTGGCAATATTGGCAAAATATCGCAATTTAACGACTTAAAATATCAAATTAACCTCTAACAATTAAAGAAAT

CDS

ATGCTAGACATAAAACTCTCGTTACAACCAGATACGGAACAAAAACTTAAGACTATTCTCAGCAGTGGCATTGATAATGAAAGATTCGCCCAAAGTGTTATTAATTACCAGATTCAAGAACTGCAACGGGGGATTTTGAATTTGAGAATTGAACTAGATGAGTTTGAAAAAAAATATCAAATGTCGTCGGAGTTATTCTATGAGCAATTTTTCCGCGGAATTTTGAACGATGAAGCAGACTTTATGGTTTGGTCGGGTTTAGTGGAGTTGATGCACCGTGATCAATCACAACTCCAAGTACTAGAATAA

Protein

MLDIKLSLQPDTEQKLKTILSSGIDNERFAQSVINYQIQELQRGILNLRIELDEFEKKYQMSSELFYEQFFRGILNDEADFMVWSGLVELMHRDQSQLQVLE