Your browser is old and dusty. Try Google Chrome!

Details for sll0086

ORF sll0086
Accession NP_442476.1
Symbol
Category Drug and analog sensitivity
Definition putative arsenical pump-driving ATPase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -313 -327 13.8643 0.164
NP_440897.1_6 Forward -280 -261 -4.42619 0.276
NP_441453.1_4 Forward -154 -146 4.34598 0.257
NP_441453.1_4 Reverse -145 -153 4.24765 0.259
NP_441623.1_1 Forward -153 -135 -2.43913 0.241
NP_441818.1_6 Reverse -147 -161 7.76774 0.284
NP_443027.1_4 Forward -324 -314 8.23984 0.215
NP_443027.1_4 Forward -156 -146 7.94484 0.223
NP_442861.1_1 Forward -198 -179 17.3057 0.197
NP_442062.1_8 Reverse -145 -155 6.56821 0.123
NP_440761.1_4 Forward -159 -140 -11.6036 0.189
NP_442974.1_6 Reverse -144 -163 22.2214 0.0275
NP_441859.1_3 Reverse -309 -328 3.04693 0.25
NP_441641.1_6 Forward -324 -305 20.0457 0.0545
NP_441802.1_1 Forward -209 -190 5.40766 0.286
NP_439918.1_3 Reverse -310 -329 2.55606 0.294
NP_441200.1_4 Reverse -371 -390 10.1275 0.209
NP_440764.1_10 Forward -141 -122 11.6017 0.266
NP_441594.1_6 Reverse -280 -299 3.04771 0.238
NP_440856.1_4 Forward -329 -310 0.786102 0.164
NP_440856.1_7 Forward -87 -68 -8.752 0.278
NP_441738.1_2 Forward -219 -212 6.52862 0.261
NP_442570.1_3 Reverse -210 -229 -1.18052 0.212
NP_442570.1_3 Forward -288 -269 -5.31042 0.242
NP_441716.1_1 Reverse -265 -279 7.47274 0.169
NP_440343.1_9 Reverse -318 -337 8.16093 0.272
NP_440747.1_10 Reverse -268 -280 -12.5474 0.297
NP_441486.1_1 Forward -157 -143 0.982901 0.122
NP_442145.1_4 Forward -59 -40 25.3527 0.00989
NP_442145.1_4 Reverse -39 -58 16.9494 0.0898
NP_442634.1_4 Reverse -311 -325 1.86788 0.149
NP_440403.1_4 Reverse -203 -222 -9.047 0.268
NP_440842.1_4 Forward -58 -39 6.43711 0.135
NP_441014.1_5 Forward -152 -134 12.1139 0.251
NP_441014.1_10 Reverse -144 -163 -1.77127 0.265
NP_442848.1_9 Reverse -139 -158 2.0644 0.255
NP_443018.1_3 Forward -153 -146 12.5271 0.0523
NP_443018.1_3 Reverse -146 -153 12.5271 0.0523
NP_441634.1_8 Reverse -269 -283 -0.197071 0.25
NP_441634.1_8 Reverse -143 -157 -3.44199 0.295
NP_441634.1_8 Forward -88 -74 -4.62196 0.295
NP_440376.1_1 Forward -234 -225 -0.0986038 0.285
NP_442687.1_7 Reverse -144 -154 6.46988 0.165
NP_442485.1_3 Forward -291 -272 1.96607 0.216
NP_442485.1_3 Forward -159 -140 -4.91709 0.286
NP_441013.1_2 Forward -159 -141 -3.91409 0.295
NP_442658.1_1 Forward -156 -146 7.64939 0.213
NP_442198.1_7 Reverse -272 -291 9.93006 0.249
NP_442782.1_2 Reverse -181 -195 1.37622 0.281
NP_442321.1_1 Forward -156 -137 -7.4737 0.262
NP_441958.1_5 Reverse -144 -154 -0.314959 0.198
NP_439990.1_5 Reverse -266 -279 7.29578 0.203
NP_442376.1_2 Forward -285 -266 -12.7836 0.286
NP_442690.1_1 Reverse -379 -398 -12.6852 0.247
NP_440153.1_8 Forward -154 -141 1.78924 0.22
NP_443055.1_6 Forward -327 -309 4.73828 0.181
NP_442853.1_1 Forward -180 -161 15.5357 0.289
NP_441646.1_1 Reverse -138 -157 2.55606 0.218
NP_442431.1_10 Reverse -120 -138 3.55906 0.214
NP_440147.1_4 Reverse -143 -156 7.29578 0.0712
NP_440147.1_4 Forward -166 -153 1.00259 0.242
NP_441550.1_8 Reverse -143 -153 4.7978 0.283
NP_441916.1_7 Forward -154 -144 4.99491 0.15
NP_441916.1_7 Reverse -145 -155 3.81494 0.202
NP_441041.1_4 Forward -280 -261 -11.9969 0.256
NP_440569.1_10 Reverse -99 -118 7.11373 0.231
NP_440569.1_10 Reverse -184 -203 6.06331 0.236
NP_440703.1_9 Forward -108 -95 5.82024 0.29
NP_441725.1_5 Forward -153 -143 -0.0199663 0.223
NP_440736.1_4 Forward -104 -85 9.93006 0.265
NP_442281.1_1 Forward -159 -145 4.12889 0.206
NP_442281.1_1 Reverse -140 -154 1.67063 0.293
NP_001035871.2_7 Reverse -210 -220 16.6963 0.14
NP_442049.1_6 Reverse -204 -223 4.71934 0.247
NP_440723.1_4 Forward -283 -264 -10.227 0.272
NP_441644.1_6 Forward -154 -144 9.91099 0.0661
NP_442933.1_10 Reverse -145 -154 4.42462 0.246
NP_442933.1_10 Forward -154 -145 4.42462 0.246
NP_442554.1_8 Forward -153 -143 12.0747 0.0295
NP_442554.1_8 Reverse -146 -156 4.20827 0.193
NP_441762.1_7 Reverse -144 -156 -6.05754 0.268
NP_442142.1_4 Reverse -142 -155 2.18201 0.299
NP_442476.1_2 Forward -333 -315 16.9205 0.155
NP_442476.1_5 Forward -207 -188 17.699 0.166
NP_443009.1_5 Reverse -144 -155 7.92465 0.118
NP_442406.1_9 Forward -94 -75 -0.295539 0.291
NP_442301.1_2 Forward -262 -243 10.6184 0.189
NP_440379.1_5 Forward -289 -270 -7.86702 0.25
NP_441758.1_10 Reverse -38 -57 10.6184 0.0708
NP_441468.1_1 Reverse -146 -153 3.97235 0.277
NP_441468.1_1 Forward -153 -146 3.97235 0.277
NP_441020.2_6 Forward -156 -139 5.74204 0.291
NP_441015.1_8 Reverse -274 -293 4.42435 0.258
NP_442253.1_5 Forward -157 -140 -0.944468 0.234
NP_441637.1_9 Reverse -185 -203 1.69077 0.292
NP_441764.1_4 Reverse -39 -56 12.2735 0.193
NP_442719.1_2 Reverse -186 -204 -5.09477 0.218
NP_442808.1_1 Reverse -76 -86 13.4509 0.0481
NP_442808.1_1 Forward -281 -271 5.78111 0.141
NP_440145.1_3 Forward -164 -145 -5.9004 0.282
NP_442718.1_2 Reverse -310 -329 -6.29373 0.295
NP_442050.1_1 Forward -287 -268 8.35759 0.251
NP_442050.1_5 Forward -223 -213 7.25606 0.265
NP_442342.1_9 Forward -156 -140 5.17175 0.241
NP_441114.1_3 Forward -152 -143 7.66954 0.231
NP_440558.1_2 Forward -157 -138 -3.83545 0.239
NP_440558.1_2 Forward -231 -212 -5.50708 0.26
NP_440558.1_2 Reverse -215 -234 -6.68705 0.279
NP_440558.1_5 Reverse -213 -227 13.7659 0.295
NP_441878.1_6 Reverse -144 -154 10.4031 0.0176
NP_441878.1_6 Forward -155 -145 0.668351 0.139
NP_441557.1_5 Reverse -145 -154 -0.885252 0.26
NP_441433.1_8 Forward -108 -89 0.0977854 0.242
NP_442419.1_2 Reverse -266 -285 -1.37718 0.246
NP_442241.1_10 Forward -131 -114 18.4655 0.213
NP_441308.1_3 Reverse -130 -149 15.5357 0.146
NP_441458.1_10 Reverse -136 -155 3.53937 0.248
NP_441564.1_2 Forward -285 -266 2.75272 0.146
NP_441564.1_10 Forward -198 -179 6.58763 0.19
NP_442183.1_1 Reverse -212 -226 7.07942 0.149
NP_442397.1_9 Reverse -212 -231 12.5858 0.226
NP_442397.1_9 Forward -115 -96 8.45592 0.246
NP_442397.1_9 Forward -234 -215 3.53937 0.264
NP_440356.1_2 Forward -284 -265 2.0644 0.263
NP_440276.1_8 Reverse -204 -223 11.1109 0.232
NP_442645.1_2 Reverse -137 -156 -15.3402 0.197
NP_442888.1_6 Forward -165 -146 10.2259 0.158
NP_441037.1_4 Reverse -143 -153 6.34312 0.267
NP_442590.1_10 Reverse -132 -151 3.04771 0.297
NP_442998.1_5 Reverse -325 -335 10.1081 0.225
NP_440299.1_1 Reverse -141 -154 8.77016 0.0851
NP_440709.1_1 Forward -60 -41 -0.492971 0.295
NP_441559.1_8 Forward -158 -144 -5.90027 0.271
NP_441559.1_8 Reverse -94 -108 -7.57189 0.295
NP_440915.1_6 Forward -158 -144 1.67122 0.132
NP_442967.1_10 Reverse -128 -142 16.9741 0.222
NP_442452.1_8 Reverse -265 -279 17.6002 0.273
NP_440695.1_6 Forward -336 -322 10.0235 0.272
NP_442993.1_1 Reverse -145 -161 -10.5612 0.222
NP_442386.1_9 Forward -155 -146 13.1756 0.0406
NP_442386.1_9 Forward -328 -319 5.9975 0.23
NP_442386.1_9 Reverse -76 -85 4.62087 0.294
NP_441340.1_5 Reverse -146 -153 4.07068 0.239
NP_441340.1_5 Forward -153 -146 4.07068 0.239
NP_440586.1_1 Reverse -309 -328 -5.11376 0.28
NP_440586.1_8 Forward -153 -146 7.61025 0.227
NP_440586.1_8 Reverse -146 -153 7.61025 0.227
NP_440586.1_8 Forward -321 -314 7.51192 0.239
NP_440586.1_8 Reverse -311 -318 5.64364 0.297
NP_440192.1_4 Forward -339 -320 17.0622 0.166
NP_440027.1_3 Forward -164 -146 10.0481 0.177
NP_440027.1_3 Forward -337 -319 4.24662 0.262
NP_440027.1_8 Reverse -209 -228 4.62021 0.287
NP_439937.1_8 Reverse -121 -140 -5.31042 0.292
NP_439937.1_9 Forward -338 -321 -7.23831 0.158
NP_439937.1_9 Reverse -192 -209 -9.89323 0.215
NP_440836.1_6 Reverse -1 -15 7.9644 0.263
NP_440316.1_10 Reverse -144 -154 7.74818 0.246
NP_440316.1_10 Reverse -119 -129 6.8632 0.251
NP_439977.1_5 Forward -160 -141 3.53937 0.159
NP_442384.1_10 Forward -154 -141 7.19745 0.0866
NP_441018.1_7 Reverse -208 -227 16.2241 0.092
NP_442262.1_10 Forward -153 -146 10.4622 0.145
NP_442262.1_10 Reverse -146 -153 10.4622 0.145
NP_441689.1_1 Reverse -17 -35 23.1898 0.015
NP_440344.1_10 Forward -228 -211 -10.5809 0.185
NP_440282.1_3 Reverse -134 -153 6.78429 0.221
NP_440531.1_6 Forward -162 -143 5.60432 0.112
NP_440487.1_1 Forward -147 -128 -4.91709 0.214
NP_441965.1_7 Forward -137 -118 17.3048 0.233
NP_440297.1_9 Forward -153 -143 9.61647 0.0917
NP_440297.1_9 Reverse -225 -235 4.10993 0.245
NP_442280.1_10 Reverse -135 -153 6.81803 0.268
NP_441896.1_3 Reverse -318 -337 -2.55715 0.284
NP_442078.1_3 Forward -107 -88 2.75194 0.202
NP_440999.1_9 Forward -158 -144 6.6861 0.0962
NP_442948.1_2 Reverse -239 -258 5.211 0.256
NP_442845.1_2 Reverse -213 -227 3.34284 0.294
NP_441469.1_8 Reverse -144 -153 10.9145 0.191
NP_441469.1_8 Forward -155 -146 5.60459 0.258
NP_442337.1_8 Reverse -207 -226 -0.0988766 0.263
NP_441621.1_7 Forward -131 -117 -1.96703 0.188
NP_443062.1_1 Reverse -145 -163 8.44842 0.153
NP_442204.1_2 Forward -367 -348 7.66927 0.272
NP_442428.1_5 Forward -153 -146 4.36568 0.271
NP_442428.1_5 Reverse -146 -153 4.36568 0.271
NP_442823.1_8 Forward -195 -176 16.5191 0.177
NP_442823.1_9 Reverse -89 -108 15.9188 0.202
NP_440673.1_2 Reverse -135 -154 16.5354 0.0651
NP_442219.1_8 Forward -158 -139 7.29741 0.271
NP_440436.1_4 Reverse -146 -155 4.42421 0.265
NP_441004.1_1 Reverse -120 -139 -11.8003 0.242
NP_441004.1_1 Reverse -139 -158 -18.2901 0.299
NP_442366.1_3 Forward -172 -154 2.96908 0.118
NP_441115.1_4 Forward -323 -305 13.9813 0.0645
NP_442206.1_10 Reverse -313 -328 0.27489 0.267
NP_442206.1_10 Forward -221 -206 -0.118434 0.284
NP_443054.1_2 Reverse -76 -90 3.24451 0.24
NP_441851.1_10 Reverse -144 -154 7.35486 0.142
NP_441555.1_5 Reverse -189 -208 15.9282 0.245
NP_441542.1_4 Forward -81 -67 4.62115 0.264
NP_441668.1_4 Reverse -135 -154 9.93088 0.113
NP_440593.1_3 Forward -159 -140 -2.0655 0.221
NP_441982.1_6 Reverse -323 -332 10.48 0.296
NP_441046.1_2 Forward -119 -100 -1.37718 0.288
NP_442843.1_1 Reverse -319 -338 -11.8003 0.293
NP_441477.1_10 Forward -148 -130 4.24738 0.203
NP_442450.1_5 Reverse -143 -153 4.69992 0.297
NP_441031.1_1 Forward -62 -43 4.02695 0.293
NP_440195.1_4 Forward -363 -344 10.3242 0.168
NP_441570.1_1 Forward -227 -209 -17.2871 0.269
NP_441078.1_4 Forward -154 -145 -1.6719 0.266
NP_441078.1_4 Reverse -145 -154 -1.77023 0.266
NP_442729.1_7 Reverse -191 -209 6.60732 0.286
NP_442348.1_2 Forward -337 -328 10.8161 0.251
NP_441432.1_8 Forward -87 -78 3.14632 0.259
NP_442344.1_7 Forward -182 -163 -10.227 0.291
NP_440760.1_1 Forward -154 -135 -14.2585 0.128
NP_440760.1_1 Forward -255 -236 -19.8634 0.22
NP_442797.1_1 Forward -145 -126 -2.36049 0.252
NP_442797.1_2 Forward -143 -125 13.045 0.239
NP_442400.1_10 Forward -201 -188 7.79662 0.282
NP_442489.1_7 Forward -154 -145 -1.6719 0.235
NP_442489.1_7 Reverse -145 -154 -1.77023 0.247
NP_440386.1_1 Reverse -240 -259 -9.047 0.28
NP_441659.2_8 Forward -154 -144 5.28991 0.112
NP_441807.1_5 Forward -105 -86 9.83255 0.229
NP_442776.1_6 Forward -204 -185 8.84924 0.243
NP_442346.1_5 Reverse -144 -154 15.5163 0.00546
NP_442346.1_5 Forward -323 -313 8.23984 0.143
NP_442346.1_5 Forward -155 -145 4.89658 0.269
NP_440025.1_3 Reverse -189 -203 12.9343 0.26
NP_440459.1_2 Forward -283 -266 10.8552 0.189
NP_440010.1_10 Reverse -268 -287 12.2908 0.19
NP_442551.1_4 Forward -156 -141 -3.36336 0.287
NP_442699.1_8 Reverse -317 -336 -12.8819 0.261
NP_443015.1_3 Forward -284 -265 19.657 0.172
NP_442073.1_6 Forward -289 -270 -1.57384 0.281
NP_442199.1_5 Forward -198 -179 1.86774 0.158
NP_442140.1_3 Reverse -146 -156 12.3697 0.0632
NP_442140.1_3 Forward -153 -143 8.73149 0.119
NP_442140.1_3 Reverse -311 -321 7.05986 0.152
NP_440875.1_9 Reverse -147 -157 10.1241 0.231
NP_440875.1_9 Reverse -315 -325 9.63741 0.233
NP_442254.1_1 Reverse -133 -152 -4.81876 0.282
NP_440590.1_4 Forward -279 -266 -5.88057 0.293
NP_442497.1_10 Forward -153 -144 0.29472 0.199
NP_440227.1_2 Forward -399 -383 7.33503 0.295
NP_441239.1_9 Forward -156 -144 18.1319 0.0142
NP_441239.1_9 Reverse -143 -155 9.28209 0.11
NP_441951.1_4 Reverse -139 -158 0.491109 0.297
NP_442568.1_8 Reverse -14 -28 11.0127 0.257
NP_441892.1_1 Reverse -136 -153 -2.71443 0.227
NP_440604.1_6 Reverse -313 -332 5.01433 0.117
NP_442193.1_8 Forward -117 -98 13.3716 0.214
NP_442270.1_7 Reverse -125 -144 7.7676 0.273
NP_441508.1_1 Forward -56 -37 13.0564 0.21
NP_441508.1_1 Reverse -32 -51 10.7498 0.279
NP_441508.1_4 Forward -109 -95 15.7678 0.227
NP_440833.1_6 Forward -204 -190 17.3052 0.134
NP_441617.1_6 Reverse -99 -118 4.22769 0.157
NP_442052.1_8 Reverse -143 -153 14.7297 0.253
NP_440546.1_4 Forward -154 -144 11.4034 0.0841
NP_440546.1_4 Reverse -145 -155 11.3065 0.0872
NP_442479.1_9 Forward -202 -183 -12.2919 0.281
NP_442402.1_9 Forward -237 -218 8.75091 0.281
NP_441848.1_4 Forward -212 -196 7.35968 0.29
NP_441084.1_6 Forward -324 -310 12.5437 0.16
NP_440696.1_3 Reverse -135 -153 -3.91409 0.293
NP_440696.1_6 Reverse -150 -169 4.12936 0.288
NP_440160.1_2 Forward -228 -209 -9.24366 0.293
NP_441408.2_7 Forward -156 -137 2.85105 0.199
NP_441011.1_8 Reverse -146 -155 5.01461 0.289
NP_442533.1_6 Reverse -145 -154 14.4544 0.013
NP_442533.1_6 Forward -154 -145 6.78456 0.103
NP_440854.1_7 Forward -28 -14 14.2385 0.253
NP_441482.1_7 Reverse -139 -153 -1.5737 0.0755
NP_441482.1_7 Forward -261 -247 -11.4068 0.262
NP_441028.1_6 Reverse -198 -208 5.19112 0.265
NP_442351.1_9 Reverse -302 -316 18.0043 0.291
NP_440115.1_6 Reverse -268 -278 4.99491 0.277
NP_440007.1_9 Reverse -96 -110 6.09611 0.234
NP_441347.1_8 Forward -375 -356 15.517 0.266
NP_442492.1_2 Reverse -313 -332 1.76941 0.224
NP_441106.1_1 Forward -155 -146 4.32629 0.227
NP_439903.1_6 Forward -157 -138 -0.39464 0.282
NP_440828.1_4 Forward -139 -120 8.35677 0.104
NP_440083.1_5 Reverse -302 -321 19.1627 0.044
NP_442072.1_9 Reverse -144 -162 -23.0886 0.277
NP_441021.1_8 Reverse -140 -158 3.65739 0.226
NP_441463.1_3 Forward -329 -310 -4.22878 0.198
NP_441626.1_6 Forward -168 -150 6.40989 0.267
NP_441962.1_4 Reverse -140 -159 -1.47551 0.123
NP_441431.1_2 Forward -157 -143 17.4035 0.0294
NP_442020.1_1 Forward -104 -85 -1.37794 0.291
NP_441836.1_2 Reverse -307 -326 -0.39387 0.212
NP_441174.1_2 Forward -348 -334 13.0776 0.222
NP_442352.1_1 Forward -160 -147 16.0461 0.215
NP_440114.1_10 Reverse -145 -159 5.70279 0.296
NP_441425.1_4 Forward -72 -58 18.7808 0.282
NP_440754.1_8 Reverse -218 -237 17.3314 0.206
NP_440293.1_3 Reverse -137 -156 7.07928 0.184
NP_440293.1_9 Reverse -213 -227 11.151 0.261
NP_440766.1_5 Forward -208 -196 15.0087 0.193
NP_440766.1_5 Reverse -103 -115 8.22874 0.285
NP_442743.1_3 Reverse -268 -287 17.699 0.163
NP_442930.1_1 Forward -386 -376 14.4342 0.239
NP_439910.1_2 Forward -162 -145 -14.0225 0.177
NP_442867.1_8 Forward -220 -201 8.45592 0.233
NP_441801.1_6 Forward -230 -211 10.6184 0.221
NP_440942.1_9 Reverse -317 -336 14.4533 0.106
NP_441984.1_3 Forward -158 -140 11.3272 0.177
NP_440473.1_9 Forward -165 -146 -7.08038 0.236
NP_440554.1_4 Reverse -146 -156 3.32329 0.234
NP_442862.1_3 Reverse -89 -106 6.72535 0.263
NP_441173.1_9 Reverse -199 -207 10.9338 0.242
NP_440552.1_3 Forward -60 -41 19.4322 0.159
NP_440552.1_8 Forward -46 -29 10.3653 0.269
NP_442275.1_1 Reverse -182 -201 0.58944 0.285
NP_442638.1_3 Forward -207 -188 14.0846 0.285
NP_440175.1_6 Forward -28 -9 15.8307 0.111
NP_440175.1_7 Reverse -128 -146 15.7066 0.119
NP_441105.1_3 Reverse -134 -153 1.96607 0.108
NP_441105.1_3 Reverse -329 -348 -9.73531 0.295
NP_441852.1_6 Forward -156 -137 13.6675 0.179
NP_442290.1_8 Reverse -144 -158 18.6825 0.165
NP_441226.1_7 Reverse -129 -136 6.82361 0.246
NP_442154.1_1 Reverse -311 -329 -7.35568 0.141
NP_440988.1_10 Reverse -127 -141 3.73707 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTAAATAAAGCCCAAATTATTCTCTTACCCTACGATCCAGAAGCTTATGCAGAAAGGACTTCCGGCATTTTCACCGAAGCCATCATCGCAGAAAGAATACCGTTAGTATCTCCGGGCACCTGGATGGCCAGGGAATTAAACCAGTACGACCTCGACAGTTTAGTAGTGGATTGGCAAGCCCAATCCCTAGTATGGGCAGAAATTGACCAAAAGTTGGCCGATTCAAGCATCCATCAGCAATTAGCAGCCATGGCCCAAGCTTACCGTCGGCACCACAGCCTAGAAAGTTATGCCAAAACCCTGCAAGAAATCTGGCTTTCCCGGCATAATGGAAACATGGAAGTTAACAATATGTAACATTCCGTCTCCAATTTTTCATCTTTCTAGGCAGATCCATCC

CDS

ATGCGCGTAATTCTGATGACAGGTAAAGGGGGGGTTGGTAAAACCTCCGTTGCGGCGGCCACCGGTCTCCGTTGTGCGGAATTAGGCCATAAGACCCTAGTTCTGAGTACCGACCCTGCCCATTCCCTCGCTGACAGTTTTGATCTGGAGTTGGGCCATGAGCCTCGCCTGGTGAAGGAGAATCTTTGGGGAGCAGAATTGGATGCTTTGATGGAGTTGGAAGGCAACTGGGGCGCAGTTAAGCGTTACATTACCCAGGTATTACAGGCCCGGGGGCTAGATGGAGTACAGGCGGAGGAACTGGCCATTCTCCCTGGCATGGATGAAATTTTTGGTCTGGTGCGGATGAAACGCCACTATGACGAAGCTGATTATGATGTACTGATTATCGATTCTGCTCCCACAGGTACTGCCCTACGTCTGCTCAGTTTGCCGGAAGTGGGGGGGTGGTATATGCGACGTTTTTATAAGCCTTTACAGGGGATGTCCGTGGCCCTCAGACCATTGGTGGAACCCCTATTTAGACCGATCGCCGGTTTTTCTTTGCCCGACAAGGAAGTGATGGATGCTCCCTACGAATTTTATGAGCAAATTGAAGCCCTGGAAAAAGTGTTAACAGATAACACGCAGACTTCCGTACGTTTGGTGACCAACCCAGAAAAGATGGTGTTGAAGGAATCATTGCGGGCCCATGCCTACCTAAGTTTGTACAATGTATCCACGGATTTAGTCATTGCTAACCGGATTTTGCCCGAAACCATTGATGATCCCTTCTTCCAACGGTGGAAAAGTAACCAACAGGTCTATAAACAAGAAATTTATGACAATTTCCATCCTCTGCCGGTGAAGGAAGCGCCCCTATTCTCGGAAGAAATGTGTGGCTTAGCAGCTTTGGAAAGACTGAAGGACACTTTGTACAAAGATGAAGATCCTTCCCAGGTTTACTACAAGGAAAACACCATTAACATTGTTCAGGGCAGCAACAATGATTACAGTTTAGAACTTTATTTACCAGGTATTCCCAAAGAGCAAATTCAACTAAATAAAACTGGCGATGAGTTAAATGTTCGTATCGGTAACCATCGCCGCAACTTGGTTCTGCCCCAGGCTTTGGCGGCCCTAAGTCCCGCTGGAGCAAAAATGGAGGATGATTACCTCAAAATTAGGTTTGCTGAGGCAGTTAAACGGTAA

Protein

MRVILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPAHSLADSFDLELGHEPRLVKENLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMDEIFGLVRMKRHYDEADYDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPLQGMSVALRPLVEPLFRPIAGFSLPDKEVMDAPYEFYEQIEALEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVSTDLVIANRILPETIDDPFFQRWKSNQQVYKQEIYDNFHPLPVKEAPLFSEEMCGLAALERLKDTLYKDEDPSQVYYKENTINIVQGSNNDYSLELYLPGIPKEQIQLNKTGDELNVRIGNHRRNLVLPQALAALSPAGAKMEDDYLKIRFAEAVKR