Your browser is old and dusty. Try Google Chrome!

Details for sll0083

ORF sll0083
Accession NP_442479.1
Symbol
Category Surface polysaccharides, lipopolysaccharides and antigens
Definition phosphoheptose isomerase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -57 -71 -0.590395 0.234
NP_440795.1_7 Forward -339 -332 14.6904 0.0123
NP_440795.1_7 Reverse -332 -339 14.6904 0.0123
NP_441418.1_6 Forward -340 -321 -28.6149 0.206
NP_441418.1_6 Reverse -298 -317 -29.4015 0.224
NP_441418.1_6 Forward -286 -267 -30.5815 0.286
NP_442291.1_5 Forward -341 -325 1.14018 0.152
NP_440897.1_6 Forward -340 -321 -4.72118 0.288
NP_441453.1_4 Reverse -331 -339 16.6374 0.00633
NP_441453.1_4 Forward -340 -332 16.539 0.00633
NP_441453.1_7 Reverse -160 -167 13.4121 0.23
NP_441623.1_1 Reverse -161 -179 0.314141 0.227
NP_443043.1_7 Reverse -314 -333 11.4058 0.186
NP_440150.1_6 Forward -343 -324 2.0644 0.279
NP_442173.1_1 Forward -339 -331 17.3257 0.00633
NP_442173.1_1 Reverse -332 -340 15.4574 0.00633
NP_442173.1_5 Reverse -256 -266 15.4389 0.287
NP_442752.1_4 Forward -340 -333 13.8055 0.0199
NP_442752.1_4 Reverse -369 -376 10.5605 0.1
NP_443027.1_4 Reverse -329 -339 13.353 0.0521
NP_443027.1_4 Forward -342 -332 13.2547 0.0521
NP_441812.1_3 Reverse -368 -382 17.0108 0.0639
NP_442975.1_10 Forward -311 -297 8.16044 0.105
NP_442975.1_10 Forward -158 -144 6.88214 0.156
NP_442975.1_10 Reverse -327 -341 3.44058 0.259
NP_440784.1_7 Forward -339 -332 15.9687 0.0123
NP_440784.1_7 Reverse -332 -339 15.9687 0.0123
NP_440061.1_9 Forward -342 -328 9.73373 0.14
NP_440061.1_9 Reverse -255 -269 7.57046 0.202
NP_440061.1_9 Reverse -329 -343 6.68548 0.235
NP_440061.1_9 Forward -338 -324 4.91554 0.3
NP_441054.1_4 Forward -350 -332 6.41066 0.109
NP_442062.1_8 Forward -340 -330 19.1546 0.00121
NP_442062.1_8 Reverse -331 -341 7.84651 0.0871
NP_442062.1_8 Forward -266 -256 5.38824 0.172
NP_440304.1_4 Forward -342 -332 10.8948 0.051
NP_440304.1_4 Forward -268 -258 4.10993 0.272
NP_440304.1_4 Reverse -276 -286 3.02829 0.299
NP_442242.1_4 Forward -339 -332 14.3954 0.0124
NP_442242.1_4 Reverse -332 -339 14.3954 0.0124
NP_440916.1_1 Forward -176 -162 12.7826 0.206
NP_440893.1_3 Reverse -320 -339 1.57197 0.273
NP_441083.1_3 Reverse -81 -91 12.8609 0.242
NP_441083.1_5 Reverse -331 -341 2.04498 0.195
NP_441083.1_5 Forward -340 -330 1.55333 0.204
NP_441434.1_1 Forward -141 -127 6.88704 0.297
NP_441434.1_3 Forward -180 -161 -0.0988766 0.227
NP_441738.1_2 Reverse -333 -340 15.28 0.0102
NP_441738.1_2 Forward -338 -331 11.5435 0.084
NP_441558.1_5 Forward -342 -323 16.9124 0.0255
NP_440209.1_1 Forward -340 -332 18.1123 0.00295
NP_440209.1_1 Reverse -331 -339 8.57422 0.0425
NP_442889.1_8 Forward -381 -367 3.8339 0.273
NP_440447.1_6 Forward -348 -330 5.52568 0.147
NP_440056.1_5 Reverse -337 -356 18.7807 0.231
NP_441713.1_1 Forward -346 -327 2.85105 0.0572
NP_441713.1_1 Reverse -321 -340 -15.3402 0.261
NP_441716.1_1 Reverse -363 -377 5.70279 0.22
NP_441716.1_1 Forward -378 -364 4.62115 0.254
NP_441716.1_1 Forward -340 -326 4.42448 0.256
NP_441716.1_1 Forward -336 -322 3.04785 0.282
NP_441327.1_5 Reverse -121 -130 16.2243 0.164
NP_442111.1_4 Forward -341 -327 5.70279 0.154
NP_442111.1_4 Reverse -330 -344 1.86788 0.293
NP_441624.1_7 Forward -372 -358 11.5043 0.201
NP_440906.1_5 Forward -339 -332 15.8704 0.0124
NP_440906.1_5 Reverse -332 -339 15.8704 0.0124
NP_440747.1_10 Reverse -328 -340 -2.4193 0.0434
NP_440747.1_10 Forward -343 -331 -2.51763 0.0509
NP_440747.1_10 Reverse -366 -378 -12.0557 0.199
NP_441486.1_1 Reverse -59 -73 -4.62196 0.204
NP_441486.1_1 Reverse -328 -342 -4.81863 0.209
NP_441486.1_1 Reverse -148 -162 -6.29359 0.288
NP_442634.1_2 Reverse -325 -344 0.294447 0.293
NP_442634.1_4 Forward -342 -328 -1.27871 0.149
NP_441014.1_10 Forward -92 -73 -0.886293 0.254
NP_441012.1_4 Forward -69 -56 5.62415 0.291
NP_443018.1_3 Forward -339 -332 14.8871 0.0123
NP_443018.1_3 Reverse -332 -339 14.8871 0.0123
NP_443018.1_3 Reverse -63 -70 7.6106 0.156
NP_441634.1_8 Forward -303 -289 0.392915 0.231
NP_441634.1_8 Forward -342 -328 -1.96703 0.295
NP_440376.1_1 Reverse -331 -340 9.73449 0.0365
NP_440376.1_1 Forward -340 -331 9.63616 0.0385
NP_440376.1_1 Reverse -145 -154 1.1797 0.255
NP_442687.1_7 Forward -341 -331 8.04317 0.116
NP_442687.1_7 Reverse -330 -340 6.27322 0.175
NP_442687.1_7 Reverse -146 -156 4.40493 0.249
NP_442958.1_3 Forward -351 -332 7.7676 0.156
NP_442530.1_2 Reverse -121 -131 15.2213 0.203
NP_440642.1_10 Reverse -174 -188 1.86729 0.287
NP_441763.1_5 Reverse -255 -274 1.96607 0.234
NP_441763.1_10 Forward -324 -305 14.1583 0.121
NP_442658.1_1 Reverse -329 -339 16.2041 0.00966
NP_442658.1_1 Forward -342 -332 14.2375 0.0237
NP_442782.1_2 Forward -266 -252 3.93283 0.257
NP_442782.1_2 Forward -340 -326 2.94952 0.269
NP_442782.1_2 Reverse -147 -161 2.45787 0.275
NP_442205.1_9 Reverse -325 -341 -3.28472 0.282
NP_441487.1_9 Forward -165 -146 -2.45882 0.293
NP_442937.1_5 Reverse -77 -96 8.16093 0.231
NP_441958.1_5 Forward -341 -331 19.9412 0.00158
NP_441958.1_5 Reverse -330 -340 2.53664 0.0409
NP_439905.1_1 Reverse -332 -345 15.9489 0.0737
NP_443001.1_7 Forward -83 -64 3.04771 0.279
NP_440984.1_7 Forward -345 -331 10.6193 0.122
NP_439990.1_5 Forward -345 -332 16.5389 0.0353
NP_440153.1_5 Forward -339 -325 3.14618 0.219
NP_442051.1_5 Reverse -79 -98 10.0292 0.29
NP_442002.1_9 Forward -267 -260 11.3472 0.185
NP_441294.1_7 Reverse -327 -341 13.1862 0.0727
NP_441424.1_6 Forward -344 -325 12.8642 0.296
NP_441646.1_1 Forward -293 -274 1.27776 0.232
NP_442438.1_10 Reverse -326 -340 4.22782 0.15
NP_442438.1_10 Reverse -364 -378 0.491246 0.225
NP_442566.1_2 Reverse -326 -345 1.0811 0.289
NP_440377.1_1 Forward -142 -125 14.8491 0.185
NP_441000.1_6 Forward -341 -327 14.2576 0.0396
NP_440147.1_4 Reverse -329 -342 14.9656 0.0205
NP_440147.1_4 Forward -342 -329 14.5723 0.0236
NP_441550.1_8 Forward -342 -332 15.8108 0.0132
NP_441916.1_7 Reverse -331 -341 19.6462 0.00144
NP_441916.1_7 Forward -340 -330 16.4013 0.00539
NP_441041.1_4 Reverse -363 -382 -13.3736 0.285
NP_441041.1_7 Reverse -328 -340 7.70913 0.162
NP_443063.1_7 Forward -287 -271 5.27008 0.288
NP_441725.1_5 Reverse -332 -342 1.94665 0.115
NP_439966.1_7 Forward -342 -332 14.3359 0.0203
NP_439966.1_7 Reverse -329 -339 9.71433 0.104
NP_439966.1_9 Reverse -329 -338 0.884706 0.253
NP_442941.1_3 Reverse -332 -342 19.2529 0.00262
NP_442941.1_3 Forward -339 -329 8.23984 0.0381
NP_440289.1_2 Reverse -328 -341 -4.50394 0.288
NP_440260.1_8 Reverse -360 -378 -5.58572 0.275
NP_440647.1_9 Reverse -329 -347 5.03403 0.23
NP_442500.1_8 Forward -218 -204 11.2388 0.265
NP_442012.1_2 Forward -342 -323 4.12936 0.218
NP_441556.1_4 Forward -316 -297 11.2584 0.248
NP_442982.1_5 Forward -388 -369 -3.54046 0.299
NP_441644.1_6 Reverse -331 -341 16.6958 0.00284
NP_441644.1_6 Forward -378 -368 3.42118 0.282
NP_441795.1_5 Reverse -202 -221 5.211 0.275
NP_442215.1_2 Forward -289 -273 -1.61309 0.186
NP_442247.1_8 Forward -342 -328 12.291 0.247
NP_440929.1_8 Reverse -331 -340 9.93116 0.0249
NP_440929.1_8 Forward -340 -331 9.83282 0.0254
NP_442933.1_10 Forward -340 -331 17.601 0.00325
NP_442933.1_10 Reverse -331 -340 17.601 0.00325
NP_442933.1_10 Forward -336 -327 9.93116 0.0552
NP_441751.2_8 Forward -377 -363 3.93283 0.0596
NP_441751.2_8 Reverse -332 -346 2.75286 0.0759
NP_441751.2_8 Forward -339 -325 -3.34366 0.141
NP_442554.1_8 Reverse -332 -342 17.2863 0.00543
NP_442554.1_8 Forward -339 -329 4.50326 0.184
NP_441762.1_7 Reverse -330 -342 4.07055 0.0572
NP_441762.1_7 Forward -341 -329 -4.38592 0.171
NP_442142.1_4 Forward -375 -362 9.75346 0.0873
NP_442142.1_4 Forward -343 -330 4.64028 0.214
NP_442292.1_1 Reverse -332 -341 17.5026 0.00435
NP_442292.1_1 Forward -339 -330 0.688044 0.23
NP_442476.1_6 Reverse -332 -346 4.62115 0.142
NP_442476.1_6 Forward -339 -325 3.24451 0.161
NP_442381.1_8 Reverse -328 -347 -14.1602 0.28
NP_442381.1_8 Forward -351 -332 -14.2585 0.28
NP_443009.1_5 Forward -341 -330 18.5443 0.00265
NP_443009.1_5 Forward -267 -256 4.77807 0.23
NP_443009.1_5 Reverse -330 -341 3.79477 0.278
NP_442408.2_1 Forward -286 -267 1.67108 0.187
NP_441715.1_4 Forward -339 -329 17.5813 0.0106
NP_441715.1_4 Reverse -332 -342 16.7946 0.0106
NP_441758.1_10 Reverse -125 -144 -1.77127 0.275
NP_441468.1_1 Forward -339 -332 15.8704 0.0124
NP_441468.1_1 Reverse -332 -339 15.8704 0.0124
NP_441673.1_1 Reverse -331 -340 11.1111 0.0121
NP_441673.1_1 Forward -340 -331 11.0128 0.018
NP_441876.1_9 Forward -93 -83 12.8609 0.267
NP_442868.1_6 Forward -342 -332 10.4031 0.038
NP_442868.1_6 Reverse -329 -339 1.455 0.205
NP_442719.1_2 Forward -140 -122 -11.7812 0.296
NP_442808.1_1 Reverse -330 -340 9.91099 0.0481
NP_441101.1_10 Forward -344 -325 -7.76869 0.292
NP_442050.1_1 Reverse -146 -165 6.19431 0.293
NP_442050.1_5 Forward -342 -332 15.9091 0.0091
NP_440558.1_2 Forward -290 -271 -7.27704 0.291
NP_442789.1_4 Forward -273 -254 -0.688862 0.209
NP_441878.1_6 Forward -337 -327 0.963343 0.128
NP_441878.1_6 Forward -341 -331 0.668351 0.139
NP_441878.1_6 Reverse -330 -340 0.668351 0.139
NP_441036.1_8 Reverse -330 -340 17.4829 0.0012
NP_441036.1_8 Forward -341 -331 11.7798 0.106
NP_441557.1_5 Forward -340 -331 18.6826 0.0015
NP_441557.1_5 Reverse -331 -340 10.5211 0.00695
NP_441445.1_1 Reverse -318 -337 0.687771 0.27
NP_442066.2_9 Forward -344 -331 19.7838 0.00844
NP_442066.2_9 Reverse -245 -258 11.1307 0.154
NP_440979.1_3 Forward -339 -321 12.2122 0.234
NP_442347.1_2 Reverse -332 -341 3.34298 0.284
NP_442645.1_2 Forward -348 -329 -22.9117 0.299
NP_441037.1_4 Forward -342 -332 7.22024 0.237
NP_441633.1_3 Reverse -329 -342 -1.75067 0.163
NP_441633.1_3 Reverse -255 -268 -3.02898 0.177
NP_441633.1_3 Forward -342 -329 -6.17557 0.238
NP_440136.1_2 Forward -339 -332 15.9687 0.0123
NP_440136.1_2 Reverse -332 -339 15.9687 0.0123
NP_442998.1_5 Forward -180 -170 12.4681 0.169
NP_442998.1_10 Reverse -333 -340 15.5754 0.0102
NP_442998.1_10 Forward -338 -331 5.74231 0.255
NP_442998.1_10 Forward -305 -298 4.16902 0.259
NP_440731.1_2 Reverse -357 -376 3.6377 0.295
NP_440899.1_8 Forward -40 -21 -11.3086 0.299
NP_440299.1_1 Reverse -327 -340 8.57349 0.09
NP_440299.1_1 Reverse -294 -307 4.83694 0.197
NP_440299.1_6 Reverse -297 -316 10.0292 0.208
NP_441799.1_1 Forward -344 -330 16.5185 0.0145
NP_441799.1_1 Reverse -327 -341 15.1419 0.0203
NP_441799.1_1 Forward -164 -150 4.62054 0.242
NP_441007.1_10 Forward -345 -332 3.26421 0.182
NP_441449.1_8 Forward -315 -296 17.1802 0.209
NP_441449.1_8 Reverse -28 -47 16.0185 0.21
NP_442333.2_5 Forward -318 -299 -9.53865 0.246
NP_440256.1_1 Reverse -295 -314 3.53937 0.0518
NP_440256.1_1 Forward -343 -324 3.34271 0.0541
NP_440256.1_1 Reverse -366 -385 -10.0303 0.293
NP_441559.1_8 Reverse -326 -340 9.73436 0.0625
NP_441559.1_8 Forward -291 -277 -4.22864 0.219
NP_441559.1_8 Forward -345 -331 -7.76856 0.299
NP_440915.1_6 Reverse -327 -341 9.14437 0.0457
NP_441296.1_9 Reverse -58 -71 10.1468 0.273
NP_442785.1_7 Forward -342 -328 10.521 0.228
NP_440748.1_5 Forward -305 -286 6.19431 0.188
NP_440787.1_5 Reverse -125 -139 9.34103 0.272
NP_440306.1_8 Forward -138 -119 -0.00131823 0.211
NP_439985.1_7 Reverse -315 -334 6.4893 0.192
NP_442993.1_1 Forward -340 -324 -6.23465 0.146
NP_442993.1_1 Reverse -331 -347 -11.4462 0.247
NP_442386.1_9 Reverse -330 -339 16.7155 0.0144
NP_442386.1_9 Forward -341 -332 6.39082 0.219
NP_441340.1_5 Forward -339 -332 15.6737 0.0124
NP_441340.1_5 Reverse -332 -339 15.6737 0.0124
NP_441340.1_9 Forward -245 -235 8.93007 0.256
NP_442791.1_5 Reverse -323 -342 -10.4236 0.279
NP_440586.1_8 Forward -339 -332 13.2151 0.026
NP_440586.1_8 Reverse -332 -339 13.2151 0.026
NP_440586.1_8 Reverse -254 -261 7.02027 0.279
NP_442251.1_6 Forward -339 -332 15.2804 0.0124
NP_442251.1_6 Reverse -332 -339 15.2804 0.0124
NP_441262.1_3 Forward -340 -333 14.7888 0.0223
NP_441262.1_3 Reverse -331 -338 13.9038 0.0336
NP_440027.1_3 Forward -330 -312 2.47668 0.289
NP_443051.1_1 Forward -341 -332 19.5676 0.00335
NP_443051.1_1 Reverse -330 -339 1.08137 0.123
NP_443051.1_9 Forward -33 -19 13.0776 0.284
NP_439937.1_9 Reverse -167 -184 -10.7782 0.233
NP_439937.1_9 Forward -341 -324 -16.4814 0.287
NP_440836.1_6 Forward -134 -120 5.99778 0.294
NP_440408.1_5 Forward -346 -327 17.699 0.27
NP_440439.1_1 Forward -343 -330 11.524 0.033
NP_440439.1_1 Reverse -328 -341 9.65572 0.0447
NP_440372.1_2 Forward -339 -332 16.3621 0.0124
NP_440372.1_2 Reverse -332 -339 16.3621 0.0124
NP_442511.1_5 Reverse -76 -95 11.6148 0.265
NP_441293.1_3 Forward -242 -224 12.7979 0.291
NP_440316.1_10 Reverse -158 -168 7.84651 0.245
NP_439977.1_5 Reverse -286 -305 -2.75381 0.289
NP_440589.1_3 Reverse -311 -330 3.04771 0.279
NP_441572.1_7 Forward -346 -327 -3.24547 0.208
NP_440267.1_2 Forward -383 -369 5.30886 0.272
NP_442887.1_5 Forward -315 -296 -11.4069 0.264
NP_442384.1_10 Reverse -331 -344 16.8339 0.00722
NP_442384.1_10 Forward -340 -327 9.95071 0.047
NP_442384.1_10 Forward -262 -249 0.412608 0.291
NP_442114.1_4 Forward -340 -329 9.30178 0.17
NP_442114.1_4 Reverse -331 -342 7.23683 0.291
NP_441018.1_7 Forward -75 -56 10.5209 0.202
NP_442262.1_10 Forward -339 -332 14.1988 0.0123
NP_442262.1_10 Reverse -332 -339 14.1988 0.0123
NP_442262.1_10 Reverse -63 -70 8.8889 0.219
NP_441689.1_5 Forward -342 -332 8.3377 0.132
NP_440163.1_10 Reverse -360 -370 13.8447 0.112
NP_440282.1_10 Forward -388 -369 -5.31042 0.25
NP_440282.1_10 Forward -317 -298 -8.26035 0.26
NP_440531.1_6 Forward -348 -329 -4.32711 0.279
NP_440562.1_3 Reverse -332 -349 5.05372 0.175
NP_441965.1_10 Reverse -328 -344 7.2367 0.151
NP_441965.1_10 Forward -343 -327 5.17175 0.216
NP_441640.1_8 Reverse -63 -82 0.491109 0.187
NP_442102.1_7 Reverse -118 -137 17.0107 0.167
NP_440297.1_9 Reverse -332 -342 -0.216628 0.282
NP_441592.1_4 Reverse -327 -346 2.85105 0.186
NP_441592.1_4 Forward -340 -321 -1.37718 0.254
NP_441592.1_10 Forward -179 -165 15.0436 0.279
NP_441896.1_3 Forward -349 -330 4.52268 0.142
NP_441896.1_3 Reverse -322 -341 1.57275 0.213
NP_440999.1_9 Reverse -327 -341 7.17775 0.0896
NP_440888.1_2 Forward -340 -326 11.9953 0.0539
NP_440888.1_2 Reverse -331 -345 11.4053 0.0681
NP_440888.1_2 Reverse -56 -70 7.76712 0.184
NP_440888.1_2 Reverse -234 -248 6.88214 0.217
NP_442892.1_9 Forward -85 -71 11.7003 0.296
NP_440792.1_5 Forward -265 -246 8.16093 0.237
NP_442277.1_4 Reverse -322 -341 17.9932 0.0256
NP_442033.1_10 Reverse -329 -348 -0.197208 0.116
NP_441543.1_2 Reverse -332 -341 15.9293 0.00518
NP_441543.1_2 Forward -339 -330 15.4377 0.00784
NP_442845.1_2 Forward -77 -63 5.80112 0.224
NP_442845.1_2 Forward -346 -332 4.62115 0.256
NP_441551.1_5 Reverse -327 -343 11.3659 0.174
NP_441469.1_8 Reverse -330 -339 8.06287 0.227
NP_441469.1_8 Forward -341 -332 6.5879 0.227
NP_442337.1_6 Forward -269 -250 12.6654 0.285
NP_442578.1_7 Forward -339 -332 14.5921 0.026
NP_442578.1_7 Reverse -332 -339 14.5921 0.026
NP_440220.1_4 Reverse -29 -48 -3.14789 0.285
NP_441462.1_2 Forward -340 -330 10.5998 0.0068
NP_441462.1_2 Reverse -331 -341 10.5014 0.00824
NP_443062.1_1 Forward -336 -318 3.86557 0.282
NP_443062.1_6 Reverse -323 -342 0.687771 0.291
NP_442204.1_1 Forward -344 -333 1.82863 0.266
NP_442204.1_6 Reverse -318 -337 4.22769 0.297
NP_440454.1_5 Forward -20 -2 14.7688 0.19
NP_440516.1_2 Forward -346 -328 4.83737 0.137
NP_440516.1_2 Reverse -325 -343 2.47742 0.172
NP_440516.1_6 Forward -286 -272 6.48882 0.293
NP_440516.1_8 Forward -340 -331 9.4395 0.0183
NP_440516.1_8 Reverse -331 -340 7.17789 0.0754
NP_442428.1_5 Forward -339 -332 15.8704 0.0124
NP_442428.1_5 Reverse -332 -339 15.8704 0.0124
NP_442428.1_8 Reverse -312 -331 -0.295539 0.274
NP_442120.1_10 Forward -292 -273 -15.0452 0.289
NP_440673.1_3 Forward -338 -331 14.0021 0.0426
NP_440673.1_3 Reverse -333 -340 12.4288 0.0426
NP_440673.1_3 Reverse -64 -71 8.98723 0.203
NP_441052.1_2 Forward -378 -368 4.0116 0.168
NP_441052.1_2 Reverse -331 -341 1.94665 0.221
NP_441052.1_2 Reverse -369 -379 1.65166 0.233
NP_441052.1_2 Forward -340 -330 0.668351 0.256
NP_442219.1_9 Forward -339 -330 9.04618 0.0681
NP_442219.1_9 Reverse -332 -341 8.25953 0.0681
NP_440436.1_4 Forward -339 -330 16.9122 0.00357
NP_440436.1_4 Reverse -332 -341 9.24241 0.0871
NP_441884.1_9 Forward -180 -161 -25.4683 0.29
NP_440314.1_9 Reverse -332 -351 12.4875 0.0261
NP_441719.1_4 Forward -339 -332 16.3621 0.0124
NP_441719.1_4 Reverse -332 -339 16.3621 0.0124
NP_441719.1_6 Forward -93 -74 9.04509 0.269
NP_441733.1_10 Forward -343 -330 6.80412 0.171
NP_441004.1_1 Forward -272 -253 -17.1101 0.289
NP_441004.1_4 Forward -269 -259 9.91146 0.259
NP_442813.1_4 Reverse -174 -193 -6.68705 0.299
NP_441851.1_10 Forward -341 -331 9.7148 0.114
NP_441851.1_10 Reverse -330 -340 6.76487 0.156
NP_442622.1_5 Reverse -314 -333 -4.42544 0.2
NP_442515.1_1 Reverse -330 -344 -4.91696 0.298
NP_441683.1_5 Reverse -160 -179 7.27595 0.268
NP_442473.1_1 Reverse -232 -251 8.06259 0.237
NP_440432.1_9 Reverse -332 -347 -5.03498 0.233
NP_442843.1_1 Reverse -272 -291 -4.52377 0.239
NP_439960.1_4 Reverse -326 -345 13.175 0.264
NP_440474.1_8 Forward -291 -277 4.52221 0.276
NP_440588.1_2 Forward -349 -330 -3.44213 0.186
NP_440195.1_4 Forward -313 -294 5.211 0.29
NP_441570.1_1 Reverse -369 -387 -10.0106 0.156
NP_441078.1_4 Reverse -331 -340 9.93116 0.0203
NP_441078.1_4 Forward -340 -331 9.83282 0.0226
NP_442480.1_1 Reverse -125 -144 18.5336 0.116
NP_440707.1_9 Forward -273 -254 20.354 0.0245
NP_442443.1_1 Reverse -250 -269 0.786102 0.215
NP_442443.1_4 Reverse -119 -129 13.4509 0.233
NP_440526.1_7 Reverse -96 -115 13.1515 0.255
NP_441432.1_8 Forward -341 -332 16.8143 0.00595
NP_441432.1_8 Forward -72 -63 12.2911 0.0444
NP_441432.1_9 Forward -138 -125 15.5793 0.133
NP_442447.1_6 Forward -131 -117 18.0112 0.205
NP_442003.1_4 Forward -64 -45 9.14423 0.3
NP_442353.1_4 Forward -173 -154 9.34008 0.135
NP_442353.1_4 Reverse -325 -344 5.30853 0.184
NP_440713.1_4 Reverse -321 -340 2.94938 0.254
NP_442489.1_2 Reverse -320 -339 5.89931 0.187
NP_442489.1_7 Reverse -331 -340 10.4228 0.0151
NP_442489.1_7 Forward -340 -331 10.3245 0.0193
NP_442489.1_7 Reverse -369 -378 -1.6719 0.235
NP_442079.1_7 Forward -306 -287 13.7658 0.079
NP_442079.1_7 Forward -335 -316 8.94757 0.118
NP_440559.1_1 Forward -339 -330 8.84951 0.0586
NP_440559.1_1 Reverse -332 -341 8.65285 0.0586
NP_441659.2_8 Reverse -331 -341 18.6629 0.00133
NP_441659.2_8 Forward -340 -330 2.33998 0.205
NP_440786.1_9 Forward -218 -199 12.5858 0.291
NP_441022.1_1 Reverse -124 -133 10.491 0.299
NP_441040.1_2 Forward -282 -263 -7.4737 0.213
NP_441040.1_2 Forward -345 -326 -16.2252 0.294
NP_442346.1_5 Forward -341 -331 15.8113 0.0045
NP_442346.1_5 Reverse -330 -340 6.8632 0.188
NP_442346.1_5 Reverse -297 -307 4.60159 0.281
NP_440352.1_5 Reverse -111 -130 11.1957 0.267
NP_440545.1_5 Reverse -154 -171 4.56207 0.244
NP_441856.1_3 Reverse -328 -347 1.27776 0.213
NP_441629.1_3 Forward -385 -366 -4.42619 0.29
NP_440555.1_1 Forward -351 -332 13.9625 0.0901
NP_441744.1_8 Forward -288 -270 18.5054 0.219
NP_441888.1_7 Reverse -326 -340 3.53951 0.225
NP_441948.1_4 Reverse -324 -342 1.29745 0.133
NP_442732.1_2 Forward -228 -209 15.6107 0.249
NP_441833.1_4 Forward -339 -332 15.9687 0.0124
NP_441833.1_4 Reverse -332 -339 15.9687 0.0124
NP_441329.1_6 Forward -115 -96 11.8883 0.106
NP_442162.1_9 Forward -339 -332 16.2637 0.0124
NP_442162.1_9 Reverse -332 -339 16.2637 0.0124
NP_440671.1_4 Reverse -363 -377 11.3077 0.137
NP_442045.1_5 Forward -290 -271 -2.75381 0.294
NP_440204.1_4 Reverse -230 -249 10.2259 0.138
NP_442140.1_3 Forward -339 -329 13.943 0.0542
NP_442140.1_3 Reverse -332 -342 4.69992 0.238
NP_440875.1_9 Forward -338 -328 10.7081 0.201
NP_440875.1_9 Reverse -333 -343 7.69067 0.255
NP_440875.1_9 Reverse -324 -334 7.69067 0.255
NP_441813.1_5 Reverse -329 -339 18.6629 0.00743
NP_441813.1_5 Forward -342 -332 18.1713 0.00743
NP_440594.1_8 Reverse -332 -345 20.4715 0.0534
NP_440594.1_8 Forward -339 -326 14.1783 0.152
NP_440590.1_4 Forward -339 -326 4.34585 0.0614
NP_440590.1_4 Reverse -332 -345 3.36254 0.0746
NP_440567.1_1 Forward -339 -325 3.8345 0.135
NP_442497.1_10 Reverse -332 -341 17.601 0.00813
NP_442497.1_10 Forward -339 -330 8.55452 0.0294
NP_440821.1_4 Forward -342 -332 2.24165 0.131
NP_440821.1_4 Reverse -329 -339 1.455 0.135
NP_441239.1_9 Reverse -329 -341 12.6253 0.0446
NP_441239.1_9 Forward -342 -330 11.4454 0.0607
NP_441239.1_9 Reverse -60 -72 3.57889 0.283
NP_441951.1_9 Forward -335 -316 6.19431 0.254
NP_440156.1_4 Reverse -169 -179 14.5325 0.176
NP_440542.1_2 Forward -114 -97 15.3785 0.212
NP_440665.1_1 Forward -286 -267 -16.3235 0.287
NP_440604.1_6 Reverse -327 -346 -4.6221 0.253
NP_440219.1_1 Reverse -212 -231 15.7062 0.158
NP_441017.1_6 Forward -305 -291 11.5037 0.262
NP_442629.1_5 Forward -276 -262 17.8958 0.142
NP_441541.1_1 Reverse -127 -145 -4.77261 0.285
NP_440833.1_6 Reverse -123 -137 7.96378 0.277
NP_442138.1_10 Reverse -372 -391 -6.68705 0.286
NP_440546.1_4 Reverse -331 -341 14.3121 0.0459
NP_440546.1_4 Forward -340 -330 13.5365 0.0459
NP_440546.1_4 Reverse -298 -308 8.6886 0.176
NP_441230.1_3 Forward -342 -323 3.93269 0.269
NP_440462.1_4 Reverse -362 -376 18.0925 0.116
NP_440462.1_6 Forward -342 -332 18.7612 0.00454
NP_440462.1_6 Reverse -329 -339 16.598 0.00969
NP_441184.1_3 Reverse -54 -73 5.80098 0.249
NP_440868.1_4 Reverse -327 -339 12.232 0.0245
NP_440868.1_4 Forward -344 -332 9.97041 0.0405
NP_440868.1_7 Forward -334 -315 17.8948 0.0902
NP_442479.1_1 Forward -355 -336 19.9606 0.0211
NP_442479.1_2 Forward -179 -160 21.0423 0.0295
NP_442479.1_3 Forward -313 -294 21.8289 0.0134
NP_442479.1_4 Forward -119 -102 26.2932 0.00322
NP_442479.1_5 Forward -141 -122 22.1858 0.0348
NP_442479.1_6 Forward -54 -35 18.7807 0.041
NP_442479.1_10 Forward -100 -81 20.1573 0.0217
NP_440812.1_10 Forward -272 -259 12.0157 0.259
NP_442402.1_4 Forward -137 -118 -1.27961 0.189
NP_441848.1_7 Forward -133 -114 -4.52452 0.294
NP_440653.1_10 Forward -76 -57 2.85105 0.288
NP_440696.1_3 Forward -340 -322 4.83737 0.198
NP_440843.1_9 Reverse -329 -348 18.3095 0.221
NP_442023.1_3 Reverse -18 -37 10.9134 0.294
NP_442039.1_4 Forward -339 -332 15.1821 0.0124
NP_442039.1_4 Reverse -332 -339 15.1821 0.0124
NP_442380.1_5 Forward -47 -28 15.9387 0.279
NP_442409.1_10 Forward -290 -276 14.0603 0.295
NP_442786.1_3 Reverse -125 -144 13.1758 0.267
NP_442837.1_3 Forward -339 -332 15.7721 0.0124
NP_442837.1_3 Reverse -332 -339 15.7721 0.0124
NP_440160.1_7 Forward -366 -347 21.0423 0.0579
NP_442053.1_1 Forward -340 -331 9.24284 0.068
NP_442053.1_1 Reverse -331 -340 8.94785 0.07
NP_440505.1_3 Forward -342 -332 17.188 0.00332
NP_440505.1_3 Forward -67 -57 7.45319 0.154
NP_440505.1_3 Reverse -329 -339 6.17489 0.192
NP_440505.1_7 Reverse -314 -333 -0.787193 0.271
NP_442456.1_5 Reverse -76 -94 5.82068 0.283
NP_441252.1_6 Forward -269 -262 11.9372 0.25
NP_442532.1_4 Forward -187 -169 8.06189 0.289
NP_440914.1_1 Reverse -331 -341 15.0561 0.00832
NP_441011.1_8 Forward -339 -330 18.191 0.00602
NP_441011.1_8 Reverse -332 -341 16.6177 0.00602
NP_442533.1_1 Reverse -366 -385 -16.7168 0.275
NP_442533.1_6 Forward -340 -331 15.1427 0.00675
NP_442533.1_6 Reverse -331 -340 7.47288 0.0898
NP_442533.1_6 Forward -378 -369 5.3096 0.145
NP_442533.1_6 Reverse -327 -336 3.04799 0.228
NP_442533.1_6 Reverse -82 -91 2.35967 0.259
NP_442541.1_10 Forward -91 -77 0.982316 0.292
NP_442322.1_4 Forward -328 -311 -1.53514 0.226
NP_441482.1_7 Forward -346 -332 -4.81863 0.159
NP_439944.1_9 Reverse -332 -342 9.12481 0.1
NP_442597.1_5 Forward -233 -214 15.326 0.241
NP_441028.1_6 Reverse -173 -183 9.321 0.216
NP_440116.1_8 Reverse -332 -351 -6.29373 0.205
NP_441527.1_4 Reverse -24 -43 -9.88384 0.262
NP_440115.1_6 Reverse -328 -338 5.38824 0.25
NP_440115.1_6 Forward -343 -333 4.79825 0.282
NP_440608.1_6 Reverse -332 -351 3.14526 0.29
NP_441106.1_1 Forward -341 -332 18.486 0.0028
NP_441106.1_1 Reverse -330 -339 17.306 0.00607
NP_439903.1_6 Reverse -231 -250 2.35861 0.227
NP_442306.1_10 Reverse -326 -345 -20.2567 0.202
NP_442306.1_10 Forward -345 -326 -20.3551 0.208
NP_440670.1_8 Forward -340 -331 8.94785 0.0606
NP_440670.1_8 Reverse -331 -340 8.84951 0.0606
NP_442908.1_1 Reverse -293 -312 1.76941 0.277
NP_441930.1_2 Forward -397 -387 12.5664 0.258
NP_440886.1_7 Reverse -330 -340 9.02601 0.0805
NP_440886.1_7 Reverse -264 -274 3.61784 0.272
NP_442614.1_2 Forward -340 -326 6.19444 0.291
NP_442072.1_9 Forward -341 -323 -22.6953 0.253
NP_442022.1_4 Reverse -375 -394 6.4893 0.271
NP_440907.2_8 Reverse -332 -342 9.616 0.103
NP_440907.2_8 Forward -339 -329 5.09279 0.222
NP_439967.1_1 Forward -191 -173 11.4255 0.236
NP_440326.1_7 Reverse -225 -239 18.5841 0.0498
NP_440962.1_5 Reverse -236 -246 16.6963 0.261
NP_441463.1_5 Forward -341 -327 12.1926 0.195
NP_441463.1_6 Reverse -361 -375 6.70583 0.267
NP_441463.1_6 Forward -380 -366 5.25632 0.297
NP_441626.1_2 Forward -339 -332 15.7721 0.0124
NP_441626.1_2 Reverse -332 -339 15.7721 0.0124
NP_442794.1_5 Reverse -328 -342 22.2224 0.11
NP_442615.1_1 Forward -349 -331 0.0191479 0.109
NP_442615.1_1 Reverse -322 -340 -5.68405 0.22
NP_441431.1_2 Reverse -328 -342 11.5037 0.136
NP_441431.1_3 Reverse -357 -376 2.75272 0.282
NP_441488.1_7 Forward -346 -327 16.3224 0.0543
NP_441836.1_2 Reverse -325 -344 11.7992 0.0706
NP_441836.1_2 Forward -346 -327 -5.70374 0.284
NP_440114.1_10 Reverse -331 -345 12.8809 0.0698
NP_440114.1_10 Forward -71 -57 9.93102 0.159
NP_440114.1_10 Forward -340 -326 8.45605 0.202
NP_440293.1_9 Reverse -316 -330 13.0837 0.216
NP_440766.1_5 Reverse -85 -97 7.08284 0.29
NP_442103.1_1 Forward -164 -150 14.6509 0.254
NP_439910.1_2 Reverse -323 -340 -11.7609 0.0788
NP_440457.1_1 Reverse -327 -339 1.21895 0.244
NP_440457.1_1 Forward -344 -332 -0.649339 0.271
NP_440798.1_2 Reverse -262 -276 14.0603 0.289
NP_440142.1_9 Forward -136 -122 12.192 0.289
NP_442297.1_4 Reverse -327 -346 15.9339 0.145
NP_441436.1_8 Reverse -312 -331 6.78429 0.297
NP_442509.1_9 Forward -340 -330 6.86274 0.248
NP_442509.1_9 Forward -325 -315 6.76441 0.254
NP_440524.1_2 Reverse -64 -83 2.45773 0.236
NP_440554.1_4 Forward -339 -329 18.5646 0.0131
NP_440554.1_4 Reverse -332 -342 17.9746 0.0131
NP_441845.1_6 Forward -352 -334 4.44404 0.211
NP_441885.1_5 Forward -340 -330 10.2065 0.012
NP_441885.1_5 Reverse -331 -341 1.65166 0.106
NP_440478.1_4 Forward -81 -62 11.8975 0.239
NP_440478.1_10 Reverse -329 -343 11.7993 0.181
NP_442341.1_9 Forward -380 -366 4.52221 0.299
NP_443000.1_7 Forward -342 -332 20.3345 0.00223
NP_443000.1_7 Reverse -329 -339 10.8948 0.0345
NP_441842.1_1 Forward -338 -325 16.7349 0.0433
NP_440275.1_3 Forward -342 -332 16.1063 0.0155
NP_440275.1_3 Reverse -329 -339 6.8632 0.0962
NP_440091.1_1 Reverse -327 -339 12.4287 0.0369
NP_441389.1_7 Reverse -148 -167 14.9458 0.286
NP_439962.1_4 Reverse -249 -268 -2.36049 0.226
NP_440149.1_8 Reverse -369 -388 -4.52377 0.21
NP_440216.1_1 Forward -340 -326 7.9644 0.00737
NP_440216.1_1 Reverse -331 -345 -2.65535 0.0539
NP_440216.1_2 Reverse -118 -137 14.8474 0.204
NP_440216.1_9 Forward -247 -238 5.80125 0.289
NP_440172.1_1 Forward -340 -330 10.9931 0.0445
NP_440172.1_1 Reverse -331 -341 7.84651 0.0718
NP_442015.1_10 Reverse -327 -340 5.13249 0.15
NP_441226.1_7 Forward -339 -332 14.4934 0.0123
NP_441226.1_7 Reverse -332 -339 14.4934 0.0123
NP_441111.1_7 Reverse -332 -340 18.7023 0.00294
NP_441111.1_7 Forward -339 -331 8.86921 0.0589
NP_441766.1_2 Forward -340 -331 17.896 0.00297
NP_441766.1_2 Reverse -331 -340 9.4395 0.0285
NP_440416.1_9 Forward -288 -269 -21.535 0.295
NP_443052.1_9 Reverse -255 -274 -3.63879 0.251
NP_442403.1_8 Forward -272 -253 -2.45882 0.27
NP_442226.1_8 Forward -39 -29 18.0729 0.129
NP_440261.1_5 Reverse -332 -345 4.93583 0.0478
NP_440261.1_5 Forward -339 -326 -6.56889 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATGGGCTTTGAGCACACTAAAGTCCATCACCATGCCCGTTTCTGAACCAGTGGTTTTCAGGCGATCGCTGGCCACGTAAACCCGGCCCCGAAAACTATGGCCATGTAAGCGTCGACATTTCCCTTCGTGGTGGGGCAATTGATGGGCCGCCTCAAAGGAAAACTCCTTATAAATAATCCACATAAAAATCTCAAATCACTGTCTACTCACCCTAGGATGAGGGAAAATCGTCCCCAGTGACCAAACGCTGACCCCTTTAACATTAGCCAATTTTTGCCTCCCTCGATTAAGATTAGGAACTATATTTTGGCCCCTGCCACTTTTTTATGGCAATGGGAGTCCCTAAAAGTCGAAGCTAGATTTTTTGGCTGCTTCAGGCTTTGAAAATGAGGATTTACT

CDS

ATGTCTGAATGGGTTGAACAGCGTTTACAGTCCCTTGCCAAGGCTTTCGATCAATCCTATTGCGGAGCCATTGAGGCCGTGGTAGATCTGATTTGCCAAAGATTCCAGGCGGGTAATAAATTGCTCATCTGCGGTAACGGGGGATCCGCCGCCGATGCCCAACACCTGGCCGCTGAATTTGTCGGCCGTTTCCATTTCAACCGCCAAGCCCTACCGGCGATCGCCTTGACCGCCAACAGTTCCATCCTCACGTCTGTCAGCAACGATTACACCTACGATATTGTTTTTTCCCGTCAAGTGGAAGCTTTGGGCCAACCGGGGGATATTCTTTGGGGTTTGTCCACTTCGGGTAAATCCACCAATGTGCTCCATGCGCTGAAATGTGCCAAGGATAAGGGTTTACACACCATCGGCATGGCTGGTAATAACGGTGGTTTGTTCCAGGAATTTGCTGACTATCCCCTCTTCGTCGCCGACAAAAACACTCCCTGCATCCAAGAAGTGCATTTGATGACCTACCATCACATCTGTGAACAGGTGGAATCCCGTCTCTTCGCCCAAAAGTCTGTGGGAATCAAAGTCTAG

Protein

MSEWVEQRLQSLAKAFDQSYCGAIEAVVDLICQRFQAGNKLLICGNGGSAADAQHLAAEFVGRFHFNRQALPAIALTANSSILTSVSNDYTYDIVFSRQVEALGQPGDILWGLSTSGKSTNVLHALKCAKDKGLHTIGMAGNNGGLFQEFADYPLFVADKNTPCIQEVHLMTYHHICEQVESRLFAQKSVGIKV