Your browser is old and dusty. Try Google Chrome!

Details for sll0082

ORF sll0082
Accession NP_442482.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -177 -191 14.8476 0.12
NP_441061.1_2 Reverse -246 -260 5.99778 0.126
NP_441061.1_2 Forward -253 -239 0.0979218 0.218
NP_441061.1_2 Forward -329 -315 -0.590395 0.234
NP_441061.1_2 Forward -158 -144 -1.67204 0.269
NP_440557.1_1 Forward -230 -211 -1.86883 0.278
NP_440795.1_7 Forward -253 -246 14.6904 0.0123
NP_440795.1_7 Reverse -246 -253 14.6904 0.0123
NP_440795.1_7 Reverse -151 -158 8.8889 0.188
NP_441418.1_6 Reverse -245 -264 -4.32711 0.0259
NP_441418.1_6 Forward -254 -235 -5.50708 0.027
NP_441418.1_6 Forward -95 -76 -30.7781 0.296
NP_442538.1_6 Reverse -328 -347 16.5191 0.269
NP_440897.1_6 Forward -183 -164 2.9486 0.156
NP_440897.1_6 Reverse -174 -193 -0.492971 0.183
NP_441453.1_4 Reverse -245 -253 16.539 0.00633
NP_441453.1_4 Forward -254 -246 16.539 0.00633
NP_441623.1_1 Reverse -34 -52 1.49411 0.211
NP_441623.1_1 Forward -261 -243 -4.11075 0.274
NP_442151.1_6 Reverse -320 -334 11.406 0.101
NP_442151.1_6 Forward -159 -145 11.0127 0.109
NP_442151.1_6 Forward -254 -240 6.29277 0.24
NP_442838.1_7 Forward -259 -240 -1.7705 0.143
NP_441818.1_1 Forward -253 -242 14.0211 0.0577
NP_440226.1_1 Forward -254 -235 9.63589 0.0703
NP_440226.1_1 Reverse -245 -264 8.75091 0.0823
NP_441465.1_8 Reverse -363 -381 5.91901 0.281
NP_442169.1_1 Forward -105 -86 -2.65548 0.279
NP_441630.1_3 Forward -262 -243 9.53756 0.0975
NP_440150.1_6 Forward -257 -238 1.57275 0.287
NP_442744.1_8 Reverse -261 -280 7.86593 0.152
NP_442173.1_1 Forward -253 -245 15.4574 0.00633
NP_442173.1_1 Reverse -246 -254 15.4574 0.00633
NP_442752.1_4 Forward -254 -247 13.8055 0.0199
NP_442752.1_4 Reverse -245 -252 13.8055 0.0199
NP_442752.1_4 Reverse -174 -181 10.5605 0.1
NP_442752.1_4 Forward -306 -299 5.34899 0.221
NP_443027.1_4 Forward -256 -246 13.943 0.0452
NP_443027.1_4 Forward -31 -21 8.23984 0.215
NP_443027.1_4 Reverse -243 -253 6.46988 0.275
NP_439997.1_6 Forward -398 -379 13.7658 0.177
NP_441812.1_1 Reverse -377 -391 12.6836 0.247
NP_442975.1_10 Forward -258 -244 12.0937 0.0477
NP_440784.1_7 Forward -253 -246 15.9687 0.0123
NP_440784.1_7 Reverse -246 -253 15.9687 0.0123
NP_442909.1_7 Forward -253 -239 8.45543 0.176
NP_442861.1_4 Forward -394 -375 0.785326 0.297
NP_441250.1_5 Forward -85 -66 14.9449 0.249
NP_440061.1_9 Forward -256 -242 14.0603 0.0735
NP_440110.1_8 Reverse -243 -262 0.786102 0.211
NP_441054.1_2 Forward -43 -24 9.93088 0.284
NP_441054.1_4 Reverse -235 -253 4.6407 0.151
NP_442062.1_8 Reverse -245 -255 19.4496 0.000558
NP_442062.1_8 Forward -254 -244 17.6796 0.00193
NP_441859.1_3 Forward -255 -236 25.2696 0.00836
NP_441859.1_3 Reverse -244 -263 3.24359 0.246
NP_441802.1_1 Reverse -323 -342 7.17762 0.254
NP_440304.1_4 Reverse -243 -253 17.9746 0.00654
NP_440304.1_4 Forward -256 -246 9.91146 0.051
NP_442242.1_4 Forward -253 -246 14.3954 0.0124
NP_442242.1_4 Reverse -246 -253 14.3954 0.0124
NP_440044.1_8 Reverse -246 -265 0.294447 0.202
NP_441581.1_6 Forward -263 -244 9.19552 0.297
NP_441935.1_1 Reverse -246 -265 5.30933 0.293
NP_440893.1_5 Reverse -51 -70 11.0117 0.203
NP_441208.1_1 Reverse -331 -350 -4.72043 0.263
NP_441208.1_9 Reverse -242 -256 16.5192 0.0647
NP_441208.1_9 Forward -398 -384 7.07942 0.227
NP_442110.1_7 Forward -389 -375 4.42448 0.201
NP_440856.1_4 Forward -261 -242 -0.885524 0.189
NP_440856.1_7 Reverse -132 -151 -9.34199 0.287
NP_441083.1_5 Forward -254 -244 19.3512 0.000718
NP_441083.1_5 Reverse -245 -255 11.3864 0.0159
NP_441083.1_5 Forward -159 -149 -0.511621 0.269
NP_442827.1_8 Forward -262 -243 8.06178 0.0882
NP_442245.1_7 Reverse -186 -204 11.4255 0.224
NP_441738.1_2 Forward -252 -245 15.28 0.0102
NP_441738.1_2 Reverse -247 -254 15.28 0.0102
NP_441558.1_5 Reverse -148 -167 4.12936 0.29
NP_440209.1_1 Reverse -245 -253 18.1123 0.00295
NP_440209.1_1 Forward -254 -246 18.1123 0.00295
NP_442889.1_8 Forward -89 -75 7.76712 0.141
NP_440447.1_6 Forward -348 -330 4.34571 0.173
NP_441713.1_1 Forward -368 -349 -9.83364 0.187
NP_441713.1_1 Reverse -239 -258 -9.83364 0.187
NP_441770.1_4 Reverse -142 -161 -7.27704 0.229
NP_440178.1_7 Reverse -244 -263 -11.2103 0.088
NP_440178.1_7 Forward -396 -377 -23.01 0.287
NP_442445.1_1 Reverse -315 -334 12.8808 0.24
NP_441716.1_1 Forward -254 -240 9.14437 0.124
NP_441716.1_1 Reverse -245 -259 8.84938 0.13
NP_442111.1_4 Reverse -244 -258 7.37441 0.0975
NP_440906.1_5 Forward -253 -246 15.8704 0.0124
NP_440906.1_5 Reverse -246 -253 15.8704 0.0124
NP_441209.1_7 Reverse -376 -394 19.5263 0.175
NP_440747.1_10 Reverse -242 -254 -1.92764 0.0192
NP_440747.1_10 Forward -257 -245 -2.02597 0.0196
NP_441130.1_8 Reverse -243 -262 16.5191 0.128
NP_441130.1_10 Forward -256 -242 20.4524 0.00768
NP_441130.1_10 Reverse -243 -257 17.6992 0.0162
NP_441486.1_1 Forward -257 -243 5.1128 0.0391
NP_441486.1_1 Forward -186 -172 -3.44199 0.178
NP_441486.1_1 Reverse -242 -256 -4.4253 0.198
NP_442145.1_3 Reverse -381 -400 10.9142 0.23
NP_442634.1_4 Reverse -243 -257 2.94952 0.124
NP_442634.1_4 Forward -256 -242 -5.01529 0.228
NP_440403.1_4 Forward -263 -244 -6.39206 0.231
NP_441014.1_10 Forward -359 -340 -0.787962 0.253
NP_441014.1_10 Forward -385 -366 -0.886293 0.254
NP_442848.1_1 Forward -260 -246 -2.36035 0.263
NP_442848.1_1 Reverse -239 -253 -2.36035 0.263
NP_442848.1_9 Reverse -78 -97 2.3594 0.252
NP_441012.1_4 Forward -148 -135 12.8023 0.237
NP_443018.1_3 Forward -253 -246 14.8871 0.0123
NP_443018.1_3 Reverse -246 -253 14.8871 0.0123
NP_443018.1_3 Forward -85 -78 10.2655 0.107
NP_443018.1_3 Forward -158 -151 4.56234 0.241
NP_443018.1_3 Reverse -151 -158 4.46401 0.244
NP_441316.1_7 Forward -256 -241 3.81481 0.137
NP_441634.1_8 Reverse -243 -257 6.29277 0.114
NP_441634.1_8 Reverse -139 -153 5.01447 0.114
NP_441634.1_8 Reverse -18 -32 1.37622 0.198
NP_441634.1_8 Forward -97 -83 0.687908 0.219
NP_441634.1_8 Forward -256 -242 -3.63866 0.295
NP_440376.1_1 Forward -254 -245 19.4693 0.000692
NP_440376.1_1 Reverse -245 -254 19.4693 0.000692
NP_441588.1_4 Reverse -36 -46 5.68323 0.245
NP_442687.1_7 Reverse -244 -254 18.5646 0.0028
NP_442687.1_7 Forward -255 -245 15.8113 0.0125
NP_442687.1_7 Forward -160 -150 11.1898 0.0994
NP_442687.1_7 Reverse -173 -183 3.71661 0.292
NP_442687.1_7 Forward -307 -297 3.61828 0.299
NP_442485.1_3 Reverse -243 -262 4.42435 0.179
NP_442485.1_3 Forward -155 -136 -3.73712 0.277
NP_442485.1_3 Forward -256 -237 -4.42544 0.28
NP_441013.1_3 Forward -389 -370 11.6025 0.204
NP_441388.1_3 Forward -168 -149 7.4718 0.245
NP_441950.1_7 Forward -98 -79 -8.45701 0.287
NP_441763.1_5 Forward -365 -346 -6.58872 0.274
NP_440887.1_8 Reverse -141 -155 16.9125 0.241
NP_440360.1_10 Forward -252 -238 7.9644 0.227
NP_440360.1_10 Reverse -79 -93 2.35953 0.267
NP_442658.1_1 Forward -256 -246 18.7607 0.00222
NP_442658.1_1 Reverse -243 -253 17.6791 0.00565
NP_440141.1_8 Forward -67 -48 7.37428 0.24
NP_440141.1_8 Reverse -165 -184 6.68596 0.254
NP_440141.1_8 Forward -110 -91 4.916 0.278
NP_442782.1_2 Reverse -327 -341 10.6193 0.173
NP_440656.1_8 Forward -265 -246 -9.34199 0.282
NP_441414.1_6 Forward -299 -280 0.58944 0.227
NP_441414.1_9 Reverse -245 -264 -7.86702 0.227
NP_441414.1_9 Forward -254 -235 -9.24366 0.256
NP_442937.1_5 Forward -259 -240 11.0125 0.148
NP_442937.1_5 Reverse -72 -91 10.3242 0.165
NP_442321.1_1 Forward -88 -69 -6.88371 0.246
NP_441317.1_4 Forward -396 -382 15.3844 0.161
NP_441958.1_5 Reverse -244 -254 20.5312 0.000966
NP_441958.1_5 Forward -255 -245 12.2714 0.00183
NP_440203.1_5 Reverse -371 -381 10.9926 0.206
NP_440203.1_5 Forward -251 -241 10.4026 0.225
NP_439905.1_1 Forward -158 -145 11.524 0.204
NP_439905.1_1 Forward -253 -240 10.934 0.204
NP_440984.1_7 Reverse -240 -254 12.291 0.122
NP_440984.1_7 Reverse -145 -159 11.111 0.122
NP_440984.1_7 Forward -259 -245 9.43936 0.127
NP_439990.1_1 Forward -27 -8 14.9458 0.179
NP_439990.1_6 Reverse -358 -377 16.1257 0.112
NP_442911.1_2 Reverse -235 -254 18.4857 0.00604
NP_442911.1_2 Forward -264 -245 10.1275 0.0155
NP_442911.1_2 Reverse -164 -183 -3.04881 0.107
NP_440153.1_5 Reverse -246 -260 10.226 0.0989
NP_440153.1_8 Forward -159 -146 -3.4223 0.295
NP_442064.1_4 Reverse -67 -86 7.37347 0.242
NP_442064.1_4 Forward -393 -374 7.17681 0.245
NP_443055.1_3 Reverse -275 -294 11.982 0.234
NP_443055.1_6 Forward -158 -140 4.83661 0.181
NP_442236.1_3 Reverse -239 -258 13.5691 0.183
NP_442236.1_3 Forward -260 -241 7.96426 0.248
NP_440993.1_2 Forward -259 -243 10.4816 0.1
NP_440993.1_2 Reverse -240 -256 3.20513 0.262
NP_440827.1_3 Reverse -358 -377 12.4875 0.247
NP_442210.1_9 Forward -393 -375 12.2122 0.209
NP_440138.1_6 Reverse -246 -265 11.8967 0.123
NP_442002.1_1 Forward -142 -124 -8.63398 0.27
NP_442002.1_9 Reverse -244 -251 14.1004 0.074
NP_442002.1_9 Forward -255 -248 10.7572 0.185
NP_440809.1_9 Reverse -236 -254 -7.65067 0.225
NP_441294.1_7 Forward -258 -244 13.9541 0.0519
NP_441646.1_1 Forward -261 -242 4.71934 0.189
NP_441646.1_1 Reverse -70 -89 -0.885524 0.273
NP_442438.1_10 Forward -259 -245 4.91614 0.142
NP_442438.1_10 Reverse -156 -170 2.35953 0.178
NP_441000.1_6 Reverse -244 -258 13.5693 0.0396
NP_441000.1_6 Forward -255 -241 -5.70361 0.29
NP_442771.1_1 Reverse -243 -261 -4.79907 0.166
NP_440484.1_1 Reverse -143 -162 11.11 0.208
NP_441674.1_6 Forward -158 -139 8.55425 0.205
NP_440147.1_4 Forward -256 -243 13.0973 0.0326
NP_440147.1_4 Reverse -243 -256 12.114 0.0326
NP_440147.1_4 Forward -161 -148 1.19926 0.235
NP_441550.1_8 Reverse -243 -253 19.8424 0.00352
NP_441550.1_8 Forward -256 -246 10.501 0.066
NP_441916.1_7 Reverse -245 -255 18.4663 0.00144
NP_441916.1_7 Forward -254 -244 16.893 0.00407
NP_441916.1_7 Reverse -77 -87 3.12662 0.227
NP_441916.1_10 Reverse -372 -391 18.289 0.0888
NP_440465.1_10 Forward -257 -238 18.584 0.0523
NP_440465.1_10 Reverse -242 -261 17.699 0.0523
NP_441041.1_4 Reverse -358 -377 5.60432 0.0496
NP_441041.1_4 Forward -335 -316 -10.7186 0.236
NP_441041.1_7 Reverse -242 -254 12.568 0.0611
NP_441041.1_7 Forward -257 -245 10.2357 0.1
NP_442004.1_6 Forward -254 -240 7.9644 0.15
NP_441725.1_5 Forward -253 -243 18.7612 0.0119
NP_441725.1_5 Reverse -246 -256 9.02648 0.0553
NP_439966.1_7 Forward -256 -246 17.4824 0.00636
NP_439966.1_7 Reverse -243 -253 8.14104 0.14
NP_439966.1_9 Forward -256 -247 10.7178 0.0863
NP_439966.1_9 Forward -31 -22 6.68623 0.253
NP_439966.1_9 Reverse -243 -252 0.983037 0.253
NP_442941.1_3 Reverse -246 -256 2.53664 0.14
NP_442941.1_3 Forward -253 -243 2.43831 0.14
NP_440289.1_2 Forward -257 -244 13.0973 0.0132
NP_440289.1_2 Reverse -242 -255 4.8375 0.0644
NP_440983.1_5 Forward -186 -167 -5.01543 0.261
NP_440260.1_8 Reverse -25 -43 -7.15901 0.295
NP_442281.1_1 Forward -259 -245 10.2254 0.0608
NP_442281.1_1 Reverse -240 -254 9.83206 0.0661
NP_442281.1_1 Reverse -310 -324 3.44058 0.231
NP_442281.1_1 Forward -91 -77 3.24392 0.238
NP_441334.1_7 Reverse -243 -262 -19.0768 0.275
NP_442256.1_2 Reverse -243 -261 2.18243 0.107
NP_442256.1_2 Forward -256 -238 -8.63398 0.232
NP_001035871.2_7 Forward -148 -138 13.5497 0.219
NP_442012.1_1 Reverse -239 -258 23.1072 0.0192
NP_442012.1_1 Forward -260 -241 6.98095 0.117
NP_441457.1_7 Reverse -243 -262 0.982764 0.276
NP_442288.1_3 Forward -390 -373 10.7569 0.203
NP_441644.1_6 Forward -254 -244 15.7125 0.0048
NP_441644.1_6 Reverse -245 -255 10.1076 0.0628
NP_441644.1_6 Reverse -77 -87 6.66608 0.152
NP_441644.1_6 Forward -86 -76 4.30615 0.242
NP_441644.1_6 Forward -159 -149 3.71617 0.267
NP_441644.1_6 Reverse -114 -124 3.32285 0.288
NP_443049.1_6 Reverse -149 -159 11.5434 0.25
NP_440867.1_10 Reverse -141 -160 4.32602 0.283
NP_442215.1_2 Reverse -312 -328 -2.79306 0.204
NP_442215.1_2 Forward -256 -240 -5.25134 0.248
NP_440253.1_2 Reverse -245 -263 9.75391 0.0449
NP_440929.1_8 Forward -254 -245 19.2726 0.000701
NP_440929.1_8 Reverse -245 -254 19.2726 0.000701
NP_442933.1_10 Forward -254 -245 17.601 0.00325
NP_442933.1_10 Reverse -245 -254 17.601 0.00325
NP_442933.1_10 Forward -43 -34 8.75118 0.0688
NP_442933.1_10 Reverse -174 -183 6.98123 0.116
NP_441751.2_8 Forward -253 -239 3.44117 0.0661
NP_441751.2_8 Reverse -78 -92 -1.96703 0.132
NP_442554.1_8 Forward -253 -243 16.9913 0.0065
NP_442554.1_8 Reverse -246 -256 16.008 0.0065
NP_442554.1_8 Forward -158 -148 7.84651 0.0825
NP_442554.1_8 Reverse -78 -88 7.15819 0.0975
NP_442554.1_8 Forward -85 -75 3.71661 0.215
NP_441762.1_7 Reverse -244 -256 20.9835 0.00342
NP_441762.1_7 Forward -255 -243 11.7404 0.0142
NP_442142.1_4 Forward -153 -140 14.1783 0.0311
NP_442142.1_4 Reverse -31 -44 12.1134 0.048
NP_442142.1_4 Reverse -242 -255 6.60689 0.16
NP_442142.1_4 Forward -186 -173 6.60689 0.16
NP_442142.1_4 Forward -89 -76 6.11523 0.173
NP_442142.1_4 Forward -126 -113 6.0169 0.175
NP_442142.1_4 Forward -162 -149 5.23026 0.197
NP_442142.1_7 Forward -109 -92 14.3952 0.298
NP_442292.1_1 Reverse -246 -255 9.63616 0.0183
NP_442292.1_1 Forward -253 -244 9.53783 0.0183
NP_442292.1_1 Forward -158 -149 5.80125 0.129
NP_442476.1_6 Forward -253 -239 21.1407 0.0195
NP_442476.1_6 Reverse -246 -260 4.81781 0.142
NP_440895.1_7 Forward -41 -23 9.85225 0.188
NP_442197.1_7 Forward -70 -51 14.2574 0.214
NP_442381.1_8 Reverse -242 -261 -14.6519 0.284
NP_441523.1_6 Reverse -26 -45 2.45773 0.291
NP_443009.1_5 Reverse -244 -255 20.6093 0.001
NP_443009.1_5 Forward -255 -244 9.10461 0.0965
NP_443009.1_5 Forward -200 -189 7.62965 0.124
NP_443009.1_5 Forward -171 -160 3.49977 0.292
NP_441715.1_4 Reverse -246 -256 9.32148 0.097
NP_441715.1_4 Forward -230 -220 5.19158 0.224
NP_441715.1_9 Forward -91 -77 16.6175 0.261
NP_440357.1_3 Forward -256 -237 15.1424 0.122
NP_440357.1_3 Reverse -243 -262 3.53937 0.242
NP_440357.1_3 Forward -161 -142 1.17943 0.275
NP_442076.1_8 Reverse -234 -253 18.9773 0.107
NP_440183.1_9 Forward -157 -138 -21.24 0.299
NP_441198.1_8 Reverse -243 -253 15.2245 0.0427
NP_441198.1_8 Reverse -367 -377 10.9275 0.232
NP_441468.1_1 Forward -253 -246 15.8704 0.0124
NP_441468.1_1 Reverse -246 -253 15.8704 0.0124
NP_441468.1_1 Reverse -151 -158 3.97235 0.277
NP_441020.2_6 Reverse -243 -260 14.2968 0.0573
NP_441020.2_6 Forward -256 -239 7.217 0.237
NP_441015.1_10 Reverse -315 -334 2.75272 0.146
NP_441015.1_10 Reverse -175 -194 -3.83545 0.194
NP_441015.1_10 Reverse -145 -164 -6.29373 0.245
NP_441673.1_1 Forward -254 -245 20.8459 0.000698
NP_441673.1_1 Reverse -245 -254 20.8459 0.000698
NP_441876.1_2 Reverse -365 -384 10.6192 0.268
NP_441876.1_9 Forward -194 -184 12.0743 0.267
NP_441826.1_2 Reverse -239 -253 0.786239 0.172
NP_441826.1_2 Forward -260 -246 -0.0987402 0.204
NP_441826.1_2 Reverse -114 -128 -2.45868 0.271
NP_442811.1_2 Reverse -231 -250 9.93088 0.133
NP_442490.1_9 Reverse -233 -252 -5.70374 0.273
NP_442490.1_10 Forward -160 -142 20.3737 0.0292
NP_442868.1_6 Reverse -243 -253 16.7946 0.0131
NP_442868.1_6 Forward -256 -246 8.53483 0.0555
NP_441612.1_2 Forward -86 -76 7.00028 0.268
NP_442427.1_8 Reverse -236 -255 5.80098 0.252
NP_441944.1_10 Reverse -357 -376 20.2556 0.0176
NP_442808.1_1 Forward -255 -245 18.4657 0.00201
NP_442808.1_1 Reverse -244 -254 8.73102 0.0481
NP_442808.1_1 Forward -184 -174 5.09279 0.173
NP_442808.1_1 Forward -160 -150 4.99446 0.178
NP_441101.1_1 Reverse -243 -261 10.8356 0.286
NP_441101.1_10 Reverse -241 -260 -7.96535 0.295
NP_441882.1_6 Forward -385 -366 -3.3438 0.255
NP_442692.1_10 Reverse -193 -206 15.9398 0.216
NP_440145.1_3 Reverse -348 -367 2.85105 0.112
NP_440145.1_3 Forward -53 -34 1.96607 0.122
NP_440145.1_3 Reverse -369 -388 -5.9004 0.282
NP_442542.1_2 Forward -256 -243 11.6223 0.114
NP_442542.1_2 Forward -308 -295 6.01747 0.239
NP_442542.1_2 Reverse -243 -256 4.73917 0.298
NP_442050.1_5 Reverse -243 -253 14.9258 0.0175
NP_442050.1_5 Forward -256 -246 8.23937 0.234
NP_441114.1_3 Forward -334 -325 6.5879 0.262
NP_441048.1_4 Forward -206 -187 8.35759 0.283
NP_441518.1_3 Forward -264 -245 -14.3569 0.275
NP_441878.1_6 Reverse -244 -254 20.2362 0.0046
NP_441878.1_6 Forward -255 -245 10.4031 0.0176
NP_441878.1_6 Forward -160 -150 1.25834 0.108
NP_441878.1_6 Forward -87 -77 0.766681 0.134
NP_441878.1_6 Reverse -76 -86 0.57002 0.14
NP_441878.1_6 Reverse -149 -159 -7.59145 0.245
NP_441036.1_8 Forward -255 -245 17.7779 0.000554
NP_441036.1_8 Reverse -244 -254 8.4365 0.174
NP_441036.1_8 Reverse -240 -250 5.78156 0.258
NP_441557.1_5 Forward -254 -245 19.9609 0.000699
NP_441557.1_5 Reverse -245 -254 19.9609 0.000699
NP_441445.1_1 Forward -263 -244 12.1925 0.0739
NP_441445.1_1 Reverse -236 -255 6.78429 0.142
NP_441445.1_1 Reverse -141 -160 5.80098 0.163
NP_441445.1_1 Reverse -171 -190 -0.39387 0.291
NP_442777.1_10 Reverse -351 -370 16.8141 0.24
NP_441308.1_8 Forward -256 -246 9.22315 0.226
NP_440101.1_3 Reverse -315 -334 4.03102 0.224
NP_440101.1_3 Reverse -139 -158 3.83436 0.224
NP_442183.1_1 Forward -254 -240 18.9775 0.0065
NP_442183.1_1 Reverse -245 -259 16.8142 0.0136
NP_442183.1_1 Reverse -297 -311 5.99778 0.193
NP_441549.1_9 Reverse -241 -259 -0.7675 0.15
NP_441549.1_9 Forward -258 -240 -9.12563 0.242
NP_442347.1_2 Reverse -246 -255 11.1111 0.056
NP_442347.1_2 Reverse -21 -30 5.70292 0.226
NP_442347.1_2 Forward -253 -244 3.34298 0.284
NP_441037.1_4 Reverse -243 -253 18.9151 0.00351
NP_441037.1_4 Forward -256 -246 16.2838 0.0168
NP_442317.1_6 Reverse -240 -259 17.3057 0.0832
NP_442317.1_6 Forward -259 -240 8.16093 0.216
NP_441633.1_3 Forward -256 -243 15.4572 0.0103
NP_441633.1_3 Reverse -243 -256 3.95252 0.0699
NP_442764.1_3 Reverse -314 -324 15.418 0.295
NP_442764.1_6 Forward -157 -139 1.98577 0.259
NP_440136.1_2 Forward -253 -246 15.9687 0.0123
NP_440136.1_2 Reverse -246 -253 15.9687 0.0123
NP_442590.1_10 Reverse -138 -157 6.98095 0.236
NP_442590.1_10 Reverse -161 -180 4.81767 0.27
NP_442998.1_5 Forward -81 -71 13.5497 0.158
NP_442998.1_10 Forward -252 -245 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 15.5754 0.0102
NP_440899.1_8 Reverse -45 -64 -2.45882 0.221
NP_440299.1_1 Forward -258 -245 7.68852 0.107
NP_440299.1_1 Reverse -241 -254 6.50855 0.139
NP_440299.1_1 Reverse -30 -43 5.23026 0.184
NP_440299.1_1 Forward -187 -174 4.14862 0.217
NP_440299.1_6 Forward -378 -359 5.89931 0.268
NP_441799.1_1 Reverse -241 -255 19.8618 0.00596
NP_441799.1_1 Forward -258 -244 6.19383 0.179
NP_441799.1_1 Forward -163 -149 3.73557 0.284
NP_441799.1_9 Reverse -244 -263 -0.295539 0.213
NP_440640.1_6 Forward -143 -124 4.42435 0.213
NP_441007.1_10 Reverse -240 -253 18.7022 0.0299
NP_441007.1_10 Reverse -145 -158 7.88576 0.126
NP_441007.1_10 Forward -91 -78 3.65753 0.182
NP_441007.1_10 Forward -259 -246 1.9859 0.202
NP_442201.1_10 Forward -265 -246 -5.99873 0.181
NP_440256.1_1 Forward -234 -215 -9.93197 0.291
NP_441559.1_8 Reverse -279 -293 0.687908 0.163
NP_441559.1_8 Forward -259 -245 -6.88358 0.281
NP_440915.1_6 Forward -258 -244 5.70279 0.0879
NP_440915.1_6 Reverse -241 -255 -2.16369 0.26
NP_441296.1_9 Forward -377 -364 14.08 0.2
NP_440717.1_1 Forward -158 -139 6.09597 0.265
NP_441464.1_8 Forward -254 -240 17.9942 0.072
NP_441464.1_8 Reverse -245 -259 9.5377 0.189
NP_440702.1_2 Reverse -172 -191 10.3242 0.145
NP_440695.1_5 Reverse -233 -252 1.47442 0.284
NP_441199.1_6 Forward -258 -239 6.58763 0.132
NP_441494.1_6 Reverse -240 -253 10.639 0.225
NP_442993.1_1 Reverse -77 -93 -5.15301 0.144
NP_442386.1_9 Forward -255 -246 15.7322 0.0144
NP_442386.1_9 Reverse -244 -253 6.39082 0.219
NP_441340.1_5 Forward -253 -246 15.6737 0.0124
NP_441340.1_5 Reverse -246 -253 15.6737 0.0124
NP_441340.1_5 Forward -158 -151 11.0522 0.0749
NP_442714.1_7 Forward -253 -234 1.47442 0.226
NP_440211.1_4 Forward -53 -43 16.008 0.215
NP_440586.1_1 Reverse -140 -159 5.30933 0.187
NP_440586.1_1 Reverse -241 -260 -5.11376 0.28
NP_440586.1_1 Reverse -238 -257 -5.11376 0.28
NP_440586.1_8 Forward -253 -246 13.2151 0.026
NP_440586.1_8 Reverse -246 -253 13.2151 0.026
NP_440586.1_8 Forward -85 -78 9.08521 0.178
NP_442251.1_6 Forward -253 -246 15.2804 0.0124
NP_442251.1_6 Reverse -246 -253 15.2804 0.0124
NP_441262.1_3 Reverse -245 -252 14.7888 0.0223
NP_441262.1_3 Forward -254 -247 14.7888 0.0223
NP_440027.1_3 Forward -159 -141 2.67334 0.289
NP_443051.1_1 Reverse -244 -253 18.0926 0.00402
NP_443051.1_1 Forward -255 -246 10.4228 0.00754
NP_439996.1_6 Reverse -140 -159 21.3238 0.04
NP_439937.1_8 Forward -256 -237 3.53937 0.204
NP_439937.1_8 Reverse -243 -262 -0.787193 0.242
NP_439937.1_8 Reverse -169 -188 -5.60541 0.299
NP_439937.1_9 Forward -255 -238 12.5261 0.0317
NP_439937.1_9 Reverse -244 -261 2.98806 0.0798
NP_439937.1_9 Forward -184 -167 -12.9415 0.278
NP_440439.1_1 Forward -257 -244 21.0621 0.0105
NP_440439.1_1 Reverse -242 -255 10.934 0.0339
NP_439943.1_1 Reverse -71 -90 -6.1954 0.237
NP_439943.1_7 Forward -357 -338 2.26107 0.298
NP_440372.1_2 Forward -253 -246 16.3621 0.0124
NP_440372.1_2 Reverse -246 -253 16.3621 0.0124
NP_441789.1_7 Reverse -322 -341 -4.32786 0.28
NP_440316.1_10 Reverse -149 -159 8.53483 0.239
NP_440139.1_1 Forward -189 -170 0.981987 0.275
NP_442384.1_10 Forward -254 -241 11.6223 0.0341
NP_442384.1_10 Reverse -174 -187 5.62415 0.124
NP_442384.1_10 Reverse -245 -258 2.2809 0.23
NP_442114.1_4 Reverse -245 -256 12.1534 0.107
NP_441018.1_7 Forward -393 -374 14.5524 0.118
NP_441018.1_7 Forward -394 -375 8.06259 0.256
NP_441018.1_7 Forward -235 -216 6.68596 0.283
NP_442790.1_4 Reverse -297 -316 -6.68705 0.144
NP_442790.1_4 Forward -263 -244 -10.0303 0.2
NP_442790.1_4 Reverse -236 -255 -10.9153 0.219
NP_442262.1_10 Forward -253 -246 14.1988 0.0123
NP_442262.1_10 Reverse -246 -253 14.1988 0.0123
NP_442262.1_10 Forward -85 -78 9.18389 0.211
NP_442262.1_10 Forward -158 -151 7.90559 0.266
NP_442244.1_3 Reverse -177 -196 5.40766 0.258
NP_440344.1_10 Reverse -238 -255 5.74204 0.0197
NP_440344.1_10 Forward -261 -244 -1.33779 0.0527
NP_440344.1_10 Reverse -167 -184 -10.9742 0.197
NP_440531.1_6 Reverse -142 -161 13.6675 0.0414
NP_442123.1_3 Reverse -245 -264 15.5357 0.115
NP_441060.1_1 Forward -398 -379 14.6161 0.248
NP_441965.1_10 Forward -257 -241 3.10679 0.274
NP_441640.1_8 Reverse -145 -164 -2.16383 0.225
NP_440297.1_9 Forward -253 -243 9.51814 0.0917
NP_440297.1_9 Reverse -246 -256 -0.216628 0.282
NP_440350.1_5 Forward -386 -367 -6.68705 0.297
NP_442280.1_10 Forward -339 -321 20.1619 0.071
NP_442280.1_10 Forward -377 -359 11.5907 0.205
NP_441896.1_3 Reverse -236 -255 3.24438 0.178
NP_440894.1_10 Forward -45 -26 2.45773 0.29
NP_442553.1_4 Forward -341 -322 11.7992 0.179
NP_440999.1_1 Forward -161 -142 2.26028 0.249
NP_440999.1_2 Reverse -375 -394 14.0608 0.165
NP_440999.1_9 Forward -258 -244 9.93102 0.0574
NP_440999.1_9 Reverse -241 -255 -0.0987402 0.199
NP_440999.1_9 Reverse -218 -232 -1.08205 0.226
NP_440999.1_9 Forward -246 -232 -2.95034 0.281
NP_440888.1_2 Reverse -245 -259 15.3386 0.0113
NP_440888.1_2 Forward -389 -375 7.96378 0.175
NP_440888.1_2 Reverse -297 -311 6.88214 0.217
NP_440888.1_2 Forward -254 -240 6.48882 0.232
NP_440888.1_2 Forward -159 -145 5.99717 0.254
NP_442948.1_2 Forward -187 -168 5.99764 0.246
NP_442277.1_4 Forward -263 -244 9.14342 0.116
NP_442033.1_10 Forward -256 -237 -6.1954 0.185
NP_442033.1_10 Reverse -243 -262 -14.4552 0.298
NP_441949.1_2 Forward -39 -20 2.65439 0.261
NP_441543.1_2 Reverse -246 -255 18.486 0.00236
NP_441543.1_2 Forward -158 -149 11.6028 0.0504
NP_441543.1_2 Forward -253 -244 9.34117 0.0818
NP_442845.1_2 Forward -92 -78 6.58777 0.207
NP_442845.1_2 Reverse -239 -253 4.52282 0.258
NP_442845.1_2 Reverse -363 -377 4.32615 0.261
NP_441551.1_5 Forward -258 -242 16.0857 0.0726
NP_441551.1_5 Reverse -241 -257 7.92432 0.241
NP_442710.1_1 Reverse -21 -40 9.53756 0.18
NP_441469.1_8 Forward -255 -246 16.126 0.00797
NP_441469.1_8 Reverse -244 -253 13.3727 0.073
NP_443064.1_6 Forward -254 -244 13.8273 0.0796
NP_442337.1_8 Forward -384 -365 2.3594 0.217
NP_442578.1_7 Forward -253 -246 14.5921 0.026
NP_442578.1_7 Reverse -246 -253 14.5921 0.026
NP_441462.1_2 Forward -254 -244 20.1379 0.000967
NP_441462.1_2 Reverse -245 -255 11.5831 0.00406
NP_441621.1_7 Reverse -243 -257 14.2576 0.0266
NP_441621.1_7 Forward -256 -242 6.3911 0.068
NP_443062.1_1 Forward -367 -349 8.93595 0.145
NP_443062.1_1 Reverse -315 -333 7.76586 0.168
NP_443062.1_1 Reverse -297 -315 4.06059 0.276
NP_443062.1_6 Reverse -237 -256 13.1758 0.0914
NP_443062.1_6 Reverse -166 -185 4.22769 0.221
NP_442204.1_5 Forward -264 -245 5.40766 0.156
NP_442204.1_5 Reverse -164 -183 1.37609 0.238
NP_440516.1_8 Forward -254 -245 16.9127 0.00442
NP_440516.1_8 Reverse -245 -254 16.9127 0.00442
NP_440516.1_8 Reverse -150 -159 -0.590259 0.283
NP_442428.1_5 Forward -253 -246 15.8704 0.0124
NP_442428.1_5 Reverse -246 -253 15.8704 0.0124
NP_442428.1_5 Reverse -151 -158 4.36568 0.271
NP_441443.1_2 Forward -167 -148 -3.83545 0.274
NP_441443.1_7 Reverse -138 -157 0.0977854 0.245
NP_442120.1_7 Reverse -315 -334 0.196116 0.195
NP_442120.1_10 Forward -395 -376 -15.9302 0.296
NP_441867.1_2 Forward -68 -49 7.47261 0.0487
NP_441867.1_2 Forward -44 -25 -3.83545 0.176
NP_440673.1_2 Reverse -140 -159 16.3403 0.0707
NP_440673.1_3 Forward -252 -245 12.4288 0.0426
NP_440673.1_3 Reverse -247 -254 12.4288 0.0426
NP_440673.1_7 Forward -265 -246 0.294447 0.271
NP_440865.1_9 Reverse -239 -258 -4.52377 0.206
NP_440865.1_9 Forward -260 -241 -9.24366 0.282
NP_441052.1_2 Reverse -245 -255 10.5014 0.0285
NP_441052.1_2 Forward -254 -244 10.4031 0.0285
NP_441052.1_2 Forward -86 -76 10.4031 0.0285
NP_441052.1_2 Forward -159 -149 7.94484 0.0576
NP_442219.1_9 Reverse -246 -255 8.35786 0.0681
NP_442219.1_9 Forward -253 -244 8.25953 0.0681
NP_440436.1_4 Reverse -246 -255 18.1905 0.00233
NP_440436.1_4 Forward -253 -244 15.9289 0.00508
NP_440436.1_4 Forward -158 -149 4.7192 0.244
NP_441884.1_8 Reverse -244 -263 0.392778 0.138
NP_441884.1_9 Reverse -242 -261 -4.91709 0.0594
NP_441884.1_9 Forward -257 -238 -5.80207 0.0594
NP_441884.1_9 Forward -162 -143 -15.8318 0.138
NP_440314.1_9 Forward -253 -234 -6.1954 0.228
NP_440314.1_9 Reverse -381 -400 -10.0303 0.282
NP_441719.1_4 Forward -253 -246 16.3621 0.0124
NP_441719.1_4 Reverse -246 -253 16.3621 0.0124
NP_441733.1_10 Reverse -242 -255 10.344 0.106
NP_441733.1_10 Forward -257 -244 9.16406 0.124
NP_441004.1_1 Forward -143 -124 -16.9135 0.287
NP_441004.1_1 Reverse -321 -340 -17.6018 0.292
NP_441004.1_2 Reverse -139 -158 -3.04881 0.271
NP_442813.1_4 Forward -236 -217 -4.22878 0.297
NP_442366.1_3 Forward -184 -166 -4.20908 0.266
NP_442366.1_3 Reverse -244 -262 -4.70074 0.275
NP_441115.1_4 Forward -232 -214 9.45814 0.213
NP_441115.1_4 Forward -255 -237 8.96649 0.229
NP_442206.1_1 Forward -254 -235 -12.5869 0.234
NP_440328.1_4 Forward -260 -241 4.03102 0.17
NP_440328.1_4 Forward -335 -316 1.96607 0.213
NP_443054.1_2 Reverse -295 -309 7.47274 0.153
NP_443054.1_2 Reverse -243 -257 4.91614 0.24
NP_443054.1_2 Forward -256 -242 1.08123 0.251
NP_441851.1_10 Reverse -244 -254 17.4829 0.0027
NP_441851.1_10 Forward -255 -245 16.008 0.00552
NP_441851.1_10 Reverse -314 -324 4.10993 0.287
NP_442208.1_5 Forward -94 -75 -7.96535 0.275
NP_442622.1_1 Reverse -244 -263 -11.8986 0.257
NP_442622.1_8 Reverse -245 -263 -19.0571 0.296
NP_442856.1_7 Forward -95 -76 2.45773 0.161
NP_442515.1_1 Forward -255 -241 14.4542 0.0276
NP_442515.1_1 Reverse -244 -258 12.291 0.0339
NP_442515.1_1 Forward -160 -146 0.0979218 0.203
NP_442515.1_1 Forward -324 -310 -3.34366 0.29
NP_441396.1_5 Reverse -237 -246 7.47288 0.252
NP_440593.1_9 Reverse -138 -152 12.0943 0.24
NP_441349.1_10 Forward -264 -245 -3.24547 0.136
NP_441409.1_6 Reverse -239 -258 -7.67036 0.154
NP_440389.1_5 Forward -261 -242 10.8728 0.295
NP_440432.1_9 Reverse -246 -261 1.45486 0.144
NP_440432.1_9 Forward -253 -238 -1.10174 0.167
NP_442843.1_1 Reverse -321 -340 -5.60541 0.244
NP_442843.1_1 Reverse -237 -256 -10.817 0.281
NP_439960.1_6 Forward -53 -34 11.0125 0.208
NP_440474.1_8 Reverse -246 -260 14.8469 0.0595
NP_440474.1_8 Reverse -78 -92 5.99717 0.235
NP_440877.1_1 Reverse -381 -400 9.3409 0.296
NP_440431.1_3 Reverse -367 -386 -7.37537 0.204
NP_442450.1_5 Reverse -243 -253 10.1081 0.115
NP_442450.1_5 Forward -161 -151 4.99491 0.271
NP_440588.1_2 Reverse -236 -255 -2.65548 0.17
NP_442006.1_2 Reverse -141 -158 -4.68105 0.137
NP_442006.1_2 Forward -263 -246 -16.5791 0.256
NP_441003.1_9 Reverse -311 -330 5.89931 0.255
NP_440483.1_1 Forward -72 -53 -7.17871 0.258
NP_441570.1_1 Reverse -245 -263 -7.84733 0.0968
NP_441570.1_1 Reverse -174 -192 -10.6989 0.177
NP_441078.1_4 Forward -254 -245 19.6659 0.0007
NP_441078.1_4 Reverse -245 -254 19.6659 0.0007
NP_441078.1_4 Reverse -150 -159 6.09625 0.0863
NP_441078.1_4 Forward -86 -77 -1.6719 0.266
NP_441078.1_4 Reverse -77 -86 -1.77023 0.266
NP_441078.1_4 Forward -159 -150 -2.06522 0.295
NP_442729.1_5 Reverse -140 -150 8.33817 0.248
NP_442729.1_8 Reverse -241 -254 10.344 0.125
NP_441663.1_8 Forward -260 -241 -2.75381 0.272
NP_442348.1_1 Forward -58 -40 19.4887 0.12
NP_442443.1_1 Reverse -142 -161 -1.86883 0.245
NP_440526.1_3 Forward -253 -242 11.3662 0.0646
NP_440526.1_3 Reverse -246 -257 2.41814 0.267
NP_440526.1_3 Forward -158 -147 0.943182 0.267
NP_441432.1_8 Reverse -149 -158 12.7828 0.0354
NP_441432.1_8 Reverse -244 -253 8.35786 0.0755
NP_441432.1_8 Forward -255 -246 8.25953 0.0755
NP_443024.1_3 Reverse -188 -198 10.2065 0.289
NP_442320.1_8 Forward -260 -246 5.70279 0.0334
NP_442320.1_8 Reverse -239 -253 -2.45868 0.0894
NP_442320.1_9 Reverse -137 -151 16.8142 0.211
NP_441732.1_2 Reverse -241 -257 -6.13632 0.0495
NP_441732.1_2 Forward -258 -242 -6.23465 0.0495
NP_441732.1_2 Forward -163 -147 -8.10294 0.116
NP_441732.1_2 Reverse -376 -392 -16.6577 0.186
NP_440629.1_6 Forward -260 -241 16.4091 0.105
NP_440760.1_1 Forward -254 -235 -20.7484 0.225
NP_442751.1_2 Forward -160 -141 3.53858 0.266
NP_441072.1_2 Forward -265 -246 5.60432 0.296
NP_440713.1_4 Forward -372 -353 5.60432 0.205
NP_442489.1_2 Reverse -169 -188 3.44104 0.236
NP_442489.1_7 Forward -254 -245 20.1576 0.000695
NP_442489.1_7 Reverse -245 -254 20.1576 0.000695
NP_442489.1_7 Reverse -77 -86 5.21127 0.077
NP_442489.1_7 Forward -86 -77 -1.6719 0.235
NP_442489.1_7 Reverse -150 -159 -1.6719 0.235
NP_442489.1_7 Reverse -174 -183 -1.77023 0.247
NP_440757.1_6 Reverse -241 -260 19.9606 0.121
NP_442079.1_7 Forward -253 -234 2.75272 0.223
NP_440559.1_1 Forward -253 -244 17.306 0.00658
NP_440559.1_1 Reverse -246 -255 8.75118 0.0586
NP_441659.2_8 Forward -254 -244 19.3512 0.000966
NP_441659.2_8 Reverse -245 -255 11.9764 0.0147
NP_442849.1_1 Reverse -336 -350 7.86607 0.282
NP_442008.1_2 Reverse -242 -261 9.83255 0.164
NP_441800.1_3 Reverse -315 -333 5.13236 0.286
NP_440779.1_5 Reverse -245 -262 -5.86102 0.152
NP_442346.1_5 Reverse -244 -254 17.9746 0.00128
NP_442346.1_5 Forward -255 -245 9.02648 0.118
NP_442346.1_5 Forward -87 -77 5.19158 0.256
NP_442346.1_5 Reverse -76 -86 4.89658 0.269
NP_442346.1_10 Reverse -139 -158 -0.590531 0.272
NP_440545.1_3 Forward -258 -241 17.7384 0.0108
NP_440545.1_3 Reverse -241 -258 10.2653 0.034
NP_440545.1_3 Forward -163 -146 -0.157821 0.149
NP_440545.1_3 Forward -333 -316 -3.30441 0.203
NP_440831.1_3 Reverse -141 -160 8.71699 0.221
NP_440486.1_4 Reverse -228 -246 0.805796 0.226
NP_440459.1_2 Reverse -355 -372 13.6085 0.128
NP_440459.1_8 Forward -303 -285 12.5072 0.195
NP_440010.1_3 Reverse -138 -157 -6.09707 0.25
NP_440010.1_4 Forward -187 -168 -2.8529 0.291
NP_440010.1_10 Reverse -138 -157 11.4058 0.209
NP_442603.1_7 Forward -254 -240 14.2569 0.0707
NP_441888.1_7 Forward -259 -245 3.93283 0.225
NP_441050.1_5 Reverse -311 -329 -1.55415 0.265
NP_441948.1_4 Forward -261 -243 -0.374176 0.139
NP_441047.1_2 Reverse -375 -394 -2.75381 0.281
NP_441833.1_4 Forward -253 -246 15.9687 0.0124
NP_441833.1_4 Reverse -246 -253 15.9687 0.0124
NP_442162.1_9 Forward -253 -246 16.2637 0.0124
NP_442162.1_9 Reverse -246 -253 16.2637 0.0124
NP_442404.1_1 Forward -355 -336 16.0265 0.139
NP_442404.1_9 Forward -251 -237 11.602 0.263
NP_442199.1_5 Reverse -237 -256 -3.54046 0.208
NP_442199.1_5 Forward -262 -243 -3.93378 0.216
NP_442199.1_5 Reverse -312 -331 -6.68705 0.28
NP_442140.1_3 Reverse -246 -256 17.4829 0.0159
NP_442140.1_3 Forward -253 -243 14.828 0.0433
NP_442140.1_3 Reverse -115 -125 12.0747 0.0664
NP_442140.1_3 Forward -158 -148 6.17489 0.184
NP_442140.1_3 Reverse -151 -161 4.60159 0.242
NP_442140.1_3 Reverse -142 -152 3.42162 0.297
NP_441671.1_10 Forward -97 -78 13.2741 0.137
NP_440875.1_9 Reverse -247 -257 15.2829 0.0295
NP_440875.1_9 Reverse -79 -89 12.9469 0.0911
NP_440875.1_9 Reverse -22 -32 8.17736 0.24
NP_440875.1_9 Forward -327 -317 7.98268 0.251
NP_440875.1_9 Reverse -224 -234 6.91198 0.294
NP_441813.1_5 Forward -256 -246 10.0098 0.0208
NP_441813.1_5 Reverse -243 -253 8.92815 0.0347
NP_440594.1_8 Forward -253 -240 9.36014 0.186
NP_441259.1_8 Reverse -326 -345 12.6833 0.254
NP_440590.1_4 Reverse -246 -259 5.13249 0.0585
NP_440590.1_4 Forward -253 -240 -3.81562 0.255
NP_440567.1_1 Forward -253 -239 17.4042 0.0153
NP_440567.1_1 Reverse -246 -260 10.6193 0.034
NP_442497.1_10 Forward -253 -244 19.8626 0.00532
NP_442497.1_10 Reverse -246 -255 10.4228 0.0087
NP_440821.1_4 Reverse -243 -253 19.5479 0.00399
NP_440821.1_4 Forward -256 -246 18.7612 0.00422
NP_441239.1_9 Forward -256 -244 19.6068 0.00769
NP_441239.1_9 Reverse -243 -255 17.0502 0.0153
NP_441239.1_9 Forward -88 -76 5.25052 0.223
NP_441239.1_9 Forward -326 -314 3.57889 0.283
NP_441951.1_4 Forward -129 -110 7.7676 0.267
NP_441727.1_3 Reverse -238 -257 14.4541 0.116
NP_441727.1_3 Forward -261 -242 4.12936 0.272
NP_441892.1_1 Forward -263 -246 9.47861 0.0722
NP_441892.1_1 Reverse -236 -253 -5.56602 0.283
NP_440604.1_6 Reverse -174 -193 -5.99873 0.289
NP_442044.1_1 Forward -259 -240 -6.78538 0.211
NP_442270.1_9 Forward -181 -162 -5.11376 0.205
NP_441017.1_6 Reverse -110 -124 12.8803 0.217
NP_441017.1_8 Reverse -187 -202 13.1562 0.174
NP_442482.1_2 Forward -388 -369 23.4022 0.0142
NP_442482.1_9 Forward -297 -279 22.6353 0.0435
NP_440949.1_7 Forward -262 -243 9.63507 0.26
NP_440354.1_5 Forward -257 -238 7.66927 0.174
NP_440546.1_4 Forward -254 -244 12.8578 0.0572
NP_440546.1_4 Reverse -245 -255 11.8882 0.0679
NP_440546.1_4 Reverse -150 -160 10.2399 0.109
NP_440546.1_4 Reverse -114 -124 9.56122 0.131
NP_441656.1_3 Forward -389 -370 9.43923 0.293
NP_440462.1_6 Forward -256 -246 17.9746 0.00578
NP_440462.1_6 Reverse -243 -253 10.4031 0.0396
NP_440462.1_6 Reverse -356 -366 3.61828 0.234
NP_442465.1_9 Reverse -381 -395 10.0294 0.298
NP_440868.1_4 Forward -258 -246 19.3118 0.0113
NP_440868.1_4 Reverse -241 -253 12.3303 0.0242
NP_440868.1_4 Reverse -146 -158 -0.551008 0.274
NP_441582.1_5 Forward -256 -237 3.63691 0.264
NP_442840.1_10 Reverse -22 -41 12.7825 0.229
NP_442402.1_9 Forward -399 -380 12.9791 0.198
NP_441084.1_6 Forward -88 -74 16.6159 0.0618
NP_440653.1_10 Forward -335 -316 10.6192 0.15
NP_440696.1_3 Reverse -140 -158 -0.374176 0.243
NP_442039.1_4 Forward -253 -246 15.1821 0.0124
NP_442039.1_4 Reverse -246 -253 15.1821 0.0124
NP_442679.1_1 Reverse -336 -355 -0.590531 0.221
NP_442696.1_2 Reverse -140 -158 10.3439 0.205
NP_442837.1_3 Forward -253 -246 15.7721 0.0124
NP_442837.1_3 Reverse -246 -253 15.7721 0.0124
NP_440160.1_2 Reverse -314 -333 -4.22878 0.26
NP_440160.1_2 Forward -341 -322 -7.27704 0.285
NP_440160.1_2 Reverse -326 -345 -8.16202 0.286
NP_442053.1_1 Forward -254 -245 18.3876 0.0007
NP_442053.1_1 Reverse -245 -254 18.3876 0.0007
NP_440505.1_3 Forward -256 -246 14.1397 0.0235
NP_440505.1_3 Forward -308 -298 10.1081 0.117
NP_440505.1_3 Reverse -243 -253 7.84651 0.147
NP_442532.1_7 Reverse -245 -259 13.2743 0.0849
NP_442532.1_7 Forward -254 -240 4.91614 0.171
NP_441408.2_7 Reverse -372 -391 4.32602 0.191
NP_441408.2_7 Forward -88 -69 -5.70374 0.299
NP_440914.1_1 Reverse -245 -255 8.6151 0.186
NP_440914.1_1 Forward -254 -244 8.51751 0.186
NP_440914.1_1 Reverse -358 -368 6.76087 0.267
NP_440914.1_1 Reverse -369 -379 6.17532 0.293
NP_442470.1_3 Forward -157 -138 11.7983 0.201
NP_441011.1_8 Reverse -246 -255 16.9127 0.00602
NP_441011.1_8 Forward -253 -244 14.356 0.0249
NP_441011.1_8 Reverse -151 -160 6.48957 0.191
NP_442533.1_1 Forward -110 -91 -12.0953 0.236
NP_442533.1_1 Reverse -171 -190 -14.4552 0.243
NP_442533.1_6 Forward -254 -245 17.2076 0.00137
NP_442533.1_6 Reverse -245 -254 17.2076 0.00137
NP_442533.1_6 Reverse -77 -86 6.8829 0.101
NP_442533.1_6 Forward -86 -77 6.78456 0.103
NP_442533.1_6 Forward -183 -174 5.40793 0.14
NP_442533.1_6 Reverse -34 -43 3.24465 0.219
NP_442533.1_6 Forward -340 -331 2.55633 0.25
NP_442232.1_3 Reverse -237 -256 -4.81876 0.163
NP_442232.1_3 Forward -262 -243 -15.8318 0.296
NP_442229.1_1 Reverse -32 -46 7.07881 0.198
NP_443016.1_1 Reverse -71 -90 1.47442 0.179
NP_443016.1_1 Forward -260 -241 -1.27885 0.219
NP_441482.1_7 Reverse -239 -253 -10.6202 0.211
NP_439944.1_9 Forward -253 -243 17.4829 0.00423
NP_439944.1_9 Reverse -246 -256 10.4031 0.0887
NP_440816.1_7 Reverse -241 -260 11.7008 0.218
NP_441749.1_7 Forward -259 -240 9.93088 0.25
NP_441028.1_6 Reverse -195 -205 3.8145 0.281
NP_442202.1_4 Forward -256 -242 16.5197 0.159
NP_442202.1_10 Forward -160 -146 17.3058 0.106
NP_441527.1_4 Reverse -367 -386 -10.8388 0.275
NP_440115.1_6 Reverse -242 -252 18.2696 0.0139
NP_440115.1_6 Forward -257 -247 9.61647 0.115
NP_440007.1_9 Reverse -311 -325 2.75286 0.277
NP_441680.1_4 Forward -185 -166 -3.24547 0.288
NP_441347.1_5 Reverse -363 -377 10.8154 0.269
NP_441602.1_3 Reverse -240 -259 -0.4922 0.224
NP_441602.1_3 Forward -259 -240 -3.24547 0.243
NP_441972.1_5 Forward -253 -234 -4.72043 0.211
NP_441972.1_5 Reverse -321 -340 -6.39206 0.229
NP_441106.1_1 Forward -255 -246 18.191 0.0028
NP_441106.1_1 Reverse -244 -253 9.73449 0.0311
NP_441825.1_4 Forward -399 -389 13.8447 0.249
NP_440480.1_10 Reverse -270 -284 15.3386 0.251
NP_442306.1_10 Reverse -240 -259 -10.1286 0.11
NP_441286.1_1 Forward -255 -243 14.6903 0.00418
NP_441286.1_1 Reverse -244 -256 5.34885 0.0259
NP_441286.1_1 Reverse -149 -161 -5.07423 0.188
NP_440670.1_8 Forward -254 -245 18.3876 0.000699
NP_440670.1_8 Reverse -245 -254 18.3876 0.000699
NP_441479.1_9 Forward -123 -105 16.3421 0.23
NP_441479.1_9 Forward -183 -165 12.2122 0.297
NP_441705.1_3 Forward -107 -88 -0.0988766 0.279
NP_441705.1_4 Reverse -129 -148 8.84924 0.256
NP_440886.1_7 Forward -255 -245 17.7774 0.0011
NP_440886.1_7 Reverse -244 -254 8.04271 0.0805
NP_440886.1_7 Forward -184 -174 7.64939 0.0865
NP_440886.1_7 Reverse -85 -95 4.20782 0.249
NP_440828.1_4 Forward -160 -141 3.73524 0.143
NP_442614.1_2 Forward -254 -240 8.35772 0.255
NP_442072.1_9 Reverse -244 -262 -21.3187 0.207
NP_441753.1_10 Forward -263 -244 5.99764 0.186
NP_441753.1_10 Reverse -236 -255 5.89931 0.186
NP_440907.2_8 Forward -253 -243 19.449 0.00351
NP_440907.2_8 Reverse -246 -256 17.4824 0.00685
NP_440907.2_8 Reverse -298 -308 4.89613 0.235
NP_442264.1_2 Forward -96 -79 9.47861 0.196
NP_442264.1_2 Reverse -235 -252 6.82368 0.25
NP_441021.1_1 Forward -253 -234 -7.76869 0.189
NP_441021.1_8 Reverse -240 -258 8.57394 0.179
NP_441021.1_8 Forward -259 -241 2.77242 0.239
NP_441463.1_3 Forward -264 -245 9.24257 0.0481
NP_441463.1_3 Reverse -235 -254 -7.4737 0.258
NP_442842.1_4 Reverse -151 -170 2.45773 0.265
NP_441626.1_2 Forward -253 -246 15.7721 0.0124
NP_441626.1_2 Reverse -246 -253 15.7721 0.0124
NP_442211.1_3 Reverse -358 -377 13.6968 0.22
NP_442365.1_5 Reverse -246 -265 14.8474 0.101
NP_442365.1_7 Reverse -241 -260 1.0811 0.175
NP_442794.1_1 Forward -333 -321 5.84051 0.203
NP_442615.1_1 Reverse -236 -254 -2.93078 0.153
NP_442615.1_1 Forward -168 -150 -6.66736 0.256
NP_441962.1_4 Reverse -240 -259 -6.09707 0.175
NP_441962.1_4 Reverse -292 -311 -12.9802 0.268
NP_441962.1_4 Forward -259 -240 -13.1769 0.271
NP_440387.1_1 Reverse -245 -261 7.82668 0.0282
NP_440387.1_1 Forward -254 -238 -1.41643 0.142
NP_441431.1_2 Forward -257 -243 17.5018 0.0276
NP_441431.1_2 Reverse -242 -256 15.2402 0.0524
NP_441431.1_2 Forward -162 -148 5.89884 0.284
NP_441431.1_2 Forward -339 -325 5.60385 0.294
NP_441488.1_7 Reverse -239 -258 10.1275 0.113
NP_441836.1_2 Reverse -174 -193 1.86774 0.185
NP_441993.1_7 Forward -42 -28 20.7474 0.118
NP_442084.1_6 Reverse -334 -352 6.31233 0.224
NP_440143.1_1 Forward -95 -76 19.764 0.205
NP_441174.1_2 Reverse -242 -256 12.1926 0.261
NP_440358.1_8 Reverse -66 -85 1.57275 0.246
NP_440114.1_10 Forward -254 -240 14.5526 0.0382
NP_440114.1_10 Reverse -245 -259 13.1759 0.0632
NP_440114.1_10 Reverse -77 -91 5.80112 0.292
NP_441817.1_3 Forward -265 -246 11.6025 0.226
NP_442437.1_8 Forward -253 -234 2.94938 0.296
NP_440287.1_5 Reverse -299 -318 10.815 0.286
NP_440287.1_5 Reverse -86 -105 8.4551 0.286
NP_441720.1_2 Reverse -241 -260 5.01354 0.224
NP_440766.1_4 Reverse -241 -255 7.86607 0.0871
NP_440766.1_4 Forward -258 -244 5.40779 0.112
NP_440766.1_4 Forward -127 -113 2.45787 0.184
NP_439988.1_3 Forward -328 -314 3.53951 0.298
NP_441237.1_9 Forward -253 -243 17.2863 0.00348
NP_441237.1_9 Forward -323 -313 14.1397 0.0488
NP_441979.1_5 Reverse -168 -187 -10.6203 0.228
NP_442743.1_1 Forward -339 -320 5.60352 0.271
NP_440457.1_1 Reverse -241 -253 9.97041 0.092
NP_440457.1_1 Forward -258 -246 0.23564 0.25
NP_440798.1_6 Reverse -246 -259 12.0157 0.0535
NP_440798.1_6 Forward -253 -240 2.96921 0.158
NP_440798.1_6 Reverse -151 -164 -0.0790467 0.297
NP_440142.1_7 Reverse -359 -378 10.9142 0.203
NP_440054.1_4 Forward -262 -243 13.4708 0.148
NP_440473.1_9 Forward -265 -246 11.7992 0.0392
NP_442509.1_9 Forward -254 -244 17.3841 0.00128
NP_442509.1_9 Reverse -245 -255 16.2041 0.00739
NP_442509.1_9 Reverse -20 -30 7.55106 0.214
NP_441440.1_1 Forward -41 -22 7.47261 0.284
NP_440554.1_4 Reverse -246 -256 13.943 0.0218
NP_440554.1_4 Forward -253 -243 6.27322 0.123
NP_441885.1_5 Reverse -245 -255 11.4848 0.00668
NP_441885.1_5 Forward -254 -244 11.3864 0.00668
NP_441885.1_5 Forward -306 -296 -1.49493 0.264
NP_440478.1_10 Forward -256 -242 7.57108 0.261
NP_441428.1_8 Reverse -237 -256 3.24438 0.251
NP_442310.1_1 Reverse -133 -152 11.4058 0.27
NP_442341.1_7 Forward -255 -241 14.9459 0.0256
NP_442341.1_7 Forward -184 -170 10.7177 0.0615
NP_442341.1_7 Reverse -244 -258 9.63603 0.0726
NP_442341.1_9 Forward -326 -312 8.94708 0.162
NP_441173.1_6 Reverse -15 -34 4.52268 0.244
NP_442534.1_8 Reverse -112 -131 16.4207 0.142
NP_440409.1_1 Reverse -142 -161 1.57275 0.184
NP_443000.1_7 Reverse -243 -253 2.14332 0.226
NP_443000.1_7 Forward -256 -246 2.04498 0.226
NP_440507.2_3 Forward -263 -244 8.4551 0.253
NP_442513.1_5 Reverse -142 -161 12.9783 0.265
NP_440727.1_2 Reverse -142 -161 -4.13045 0.295
NP_441842.1_1 Forward -252 -239 11.8184 0.241
NP_441842.1_10 Forward -261 -247 18.3875 0.0173
NP_441842.1_10 Reverse -238 -252 16.9125 0.0273
NP_440275.1_3 Reverse -243 -253 19.5479 0.00756
NP_440275.1_3 Forward -256 -246 17.9746 0.0082
NP_440091.1_1 Forward -258 -246 17.7386 0.013
NP_440091.1_1 Reverse -241 -253 0.825626 0.227
NP_441307.1_4 Forward -230 -211 -0.295539 0.259
NP_442354.1_8 Forward -349 -330 7.66927 0.266
NP_442275.1_1 Reverse -141 -160 2.45773 0.284
NP_440679.1_10 Reverse -143 -162 -19.2734 0.279
NP_443010.1_10 Forward -257 -240 23.3538 0.00843
NP_442753.1_3 Reverse -346 -364 23.2253 0.0224
NP_439962.1_4 Forward -161 -142 -5.31042 0.278
NP_440149.1_8 Reverse -245 -264 -5.70374 0.231
NP_440149.1_8 Forward -129 -110 -6.68705 0.258
NP_440149.1_8 Reverse -174 -193 -8.06369 0.298
NP_441105.1_3 Reverse -234 -253 -4.6221 0.203
NP_440216.1_1 Reverse -245 -259 6.58777 0.0145
NP_440216.1_1 Forward -254 -240 -1.27871 0.0303
NP_440216.1_6 Forward -190 -174 1.23851 0.237
NP_440216.1_9 Reverse -376 -385 15.536 0.128
NP_440216.1_9 Forward -84 -75 6.39124 0.289
NP_440678.1_9 Reverse -240 -259 7.86593 0.281
NP_440172.1_1 Forward -254 -244 16.303 0.00854
NP_440172.1_1 Reverse -245 -255 8.73149 0.0586
NP_440172.1_1 Reverse -150 -160 4.89658 0.162
NP_442290.1_8 Reverse -244 -258 18.1908 0.165
NP_442015.1_10 Reverse -241 -254 3.65753 0.178
NP_442015.1_10 Forward -258 -245 3.16588 0.185
NP_442015.1_10 Reverse -170 -183 2.57589 0.19
NP_441226.1_7 Forward -253 -246 14.4934 0.0123
NP_441226.1_7 Reverse -246 -253 14.4934 0.0123
NP_441226.1_7 Forward -366 -359 9.47853 0.147
NP_441226.1_7 Reverse -354 -361 9.47853 0.147
NP_441226.1_7 Forward -339 -332 5.34865 0.289
NP_441757.1_3 Reverse -149 -168 3.24438 0.155
NP_441111.1_7 Forward -253 -245 18.7023 0.00294
NP_441111.1_7 Reverse -246 -254 18.7023 0.00294
NP_442379.1_10 Forward -261 -244 -2.41943 0.23
NP_441766.1_2 Forward -254 -245 17.5026 0.00297
NP_441766.1_2 Reverse -245 -254 17.5026 0.00297
NP_441766.1_9 Reverse -142 -161 9.53756 0.144
NP_442252.1_3 Forward -261 -243 12.6055 0.137
NP_440416.1_9 Forward -261 -242 -11.5053 0.152
NP_440416.1_9 Forward -374 -355 -12.6852 0.159
NP_440416.1_9 Forward -190 -171 -17.5035 0.241
NP_443052.1_8 Forward -264 -245 9.14423 0.023
NP_443052.1_8 Reverse -235 -254 -12.2919 0.252
NP_440072.1_5 Reverse -141 -159 1.29745 0.236
NP_442154.1_1 Reverse -142 -160 4.24738 0.0591
NP_442154.1_1 Forward -103 -85 -15.7138 0.224
NP_442154.1_1 Reverse -133 -151 -17.4838 0.257
NP_440261.1_5 Forward -253 -240 16.5389 0.0105
NP_440261.1_5 Reverse -246 -259 -2.73398 0.0924
NP_440261.1_5 Forward -158 -145 -2.93064 0.0983
NP_440261.1_5 Reverse -151 -164 -12.4687 0.297
NP_440988.1_5 Reverse -66 -85 15.5898 0.202
NP_440988.1_10 Reverse -178 -192 8.77134 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCGGGGTTTTTGGCCTTTTCCTTGGCATTCCTTTGCCATCCGTTGGCTTTCCATTTCTTGGCCCAACCCTTGCTCATGGCATCGACCATATAGCGGGAATCGGTATAGAGCAACACTTGGGACGGTTCTTGTAAATGACTCAAGGCGGCGATCGCCCCCATAATTTCCATGCGATTATTGGTGGTCATTTTATAACCGGCGGACAATTCCTCCCGACGACCATCACCGTAGAGAATCACTGCGCCATAGCCACCAGGGCCAGGATTCATGGAGCAGGCACCATCGGTGTAGAGAGTTACGGAATTGGGGGTAGAGGCCATGGACAAATTCAGCAAGGTTAGGGTTAATGGGAAAATCAGCGCTGGTCAAGCTGGGATCATAAGCAGGATGGAAAATCAGA

CDS

GTGAACGAAGAGCGTTTTGCCGACACGAAACTAATGCGCCTACAACTTTGTTTATACCTGCTTCCCGTAGTGGGCATATTACCGTCCCTCTGGCAGTTACGCCAACCAGACCAACCTAACTGGGGCGACAATCAGCATCACCGTCAACGTCGCCGTTTAAGTCGTCGGTCATTGCAATTAACCCTAGGTTGGCTCTGCCTGTACCTATTACTCTGGGGGACTGGCCAGGGCGCGGGGGAATTGGCCGCATTTAGACTAATGTACCTAAATGGTCTGATCACCACCGGTTATTTCCTGGTGTGTTTGCTGTGGATGGGCAGAATTTTTTTCCAGCCTTTGCCATCCACTAAGAATTGA

Protein

MNEERFADTKLMRLQLCLYLLPVVGILPSLWQLRQPDQPNWGDNQHHRQRRRLSRRSLQLTLGWLCLYLLLWGTGQGAGELAAFRLMYLNGLITTGYFLVCLLWMGRIFFQPLPSTKN