Your browser is old and dusty. Try Google Chrome!

Details for sll0080

ORF sll0080
Accession NP_442487.1
Symbol argC
Category Glutamate family / Nitrogen assimilation
Definition N-acetyl-gamma-glutamyl-phosphate reductase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_8 Forward -252 -235 7.70866 0.257
NP_441623.1_1 Forward -98 -80 0.609134 0.221
NP_440561.1_4 Reverse -156 -175 11.5571 0.285
NP_441818.1_9 Reverse -261 -280 6.29264 0.148
NP_441818.1_9 Forward -349 -330 -8.35868 0.277
NP_440259.1_4 Reverse -230 -244 9.21432 0.278
NP_440150.1_2 Forward -168 -149 8.25844 0.234
NP_442655.1_5 Reverse -330 -349 17.0107 0.146
NP_442173.1_1 Forward -287 -279 9.1642 0.085
NP_442752.1_4 Reverse -154 -161 12.4288 0.0388
NP_442752.1_4 Forward -95 -88 5.54565 0.194
NP_442752.1_4 Forward -330 -323 5.44732 0.202
NP_443027.1_4 Forward -262 -252 7.25653 0.24
NP_440061.1_9 Forward -332 -318 8.16044 0.18
NP_441054.1_2 Reverse -302 -321 11.7992 0.257
NP_442062.1_8 Forward -288 -278 6.37155 0.127
NP_442062.1_8 Forward -330 -320 5.28991 0.176
NP_440304.1_4 Reverse -319 -329 7.15819 0.129
NP_440304.1_4 Reverse -277 -287 5.38824 0.211
NP_442242.1_4 Forward -287 -280 10.7572 0.153
NP_440853.1_7 Reverse -80 -99 18.584 0.0781
NP_441352.1_2 Reverse -307 -326 4.22769 0.216
NP_441208.1_9 Forward -333 -319 9.73436 0.204
NP_442276.1_2 Forward -347 -328 3.04771 0.299
NP_441082.1_10 Reverse -378 -391 10.2457 0.236
NP_441083.1_5 Forward -288 -278 6.66654 0.0811
NP_441083.1_5 Reverse -279 -289 1.25834 0.213
NP_441083.1_5 Reverse -321 -331 -0.708283 0.276
NP_441738.1_2 Reverse -323 -330 10.2652 0.101
NP_441738.1_2 Forward -87 -80 9.77352 0.143
NP_441738.1_4 Forward -369 -350 9.3409 0.172
NP_441558.1_5 Forward -332 -313 4.42435 0.281
NP_441713.1_1 Forward -336 -317 -5.01543 0.113
NP_441770.1_5 Forward -97 -78 5.211 0.213
NP_440178.1_7 Reverse -278 -297 -14.0619 0.148
NP_440659.1_9 Forward -104 -85 9.24257 0.28
NP_440747.1_10 Forward -333 -321 -2.4193 0.0434
NP_440747.1_10 Forward -291 -279 -12.0557 0.199
NP_440747.1_10 Reverse -151 -163 -12.1541 0.227
NP_441130.1_10 Forward -262 -248 6.88276 0.173
NP_441486.1_1 Forward -291 -277 -4.03198 0.186
NP_442634.1_4 Reverse -319 -333 -3.44199 0.161
NP_442634.1_4 Forward -332 -318 -3.54032 0.161
NP_442848.1_1 Forward -294 -280 -0.295402 0.263
NP_441012.1_4 Reverse -253 -266 10.639 0.262
NP_441012.1_4 Forward -375 -362 6.4108 0.279
NP_440376.1_1 Forward -330 -321 13.4711 0.016
NP_440376.1_1 Forward -288 -279 6.48957 0.0963
NP_440376.1_1 Reverse -321 -330 -0.0986038 0.285
NP_440376.1_1 Reverse -279 -288 -0.0986038 0.285
NP_440376.1_1 Reverse -189 -198 -0.393597 0.289
NP_441588.1_4 Reverse -200 -210 5.78156 0.235
NP_442687.1_7 Reverse -278 -288 8.82982 0.1
NP_442687.1_7 Forward -378 -368 5.87989 0.183
NP_440781.1_6 Forward -231 -213 7.19731 0.265
NP_440642.1_10 Reverse -240 -254 5.01387 0.243
NP_441682.1_1 Forward -296 -277 21.8289 0.0575
NP_441422.1_7 Forward -332 -315 -8.12263 0.266
NP_440667.1_2 Forward -263 -244 -9.24366 0.299
NP_442658.1_1 Reverse -319 -329 10.1076 0.132
NP_442658.1_1 Reverse -172 -182 8.3377 0.199
NP_440141.1_8 Forward -110 -91 5.89931 0.271
NP_440662.1_2 Forward -296 -277 1.57275 0.201
NP_442205.1_9 Reverse -315 -331 -0.629782 0.264
NP_441958.1_5 Reverse -320 -330 1.65166 0.0872
NP_441958.1_5 Forward -331 -321 1.65166 0.0872
NP_441958.1_5 Reverse -278 -288 0.963343 0.12
NP_441127.1_1 Forward -260 -246 9.04604 0.283
NP_440203.1_5 Reverse -323 -333 12.3692 0.154
NP_440203.1_5 Reverse -254 -264 8.63269 0.29
NP_439905.1_1 Forward -182 -169 12.3107 0.203
NP_441097.1_2 Reverse -292 -309 5.34871 0.259
NP_439990.1_5 Forward -335 -322 6.90245 0.22
NP_442376.1_2 Reverse -316 -335 -5.9004 0.286
NP_442911.1_2 Reverse -311 -330 -2.45882 0.0982
NP_442911.1_2 Forward -298 -279 -3.54046 0.114
NP_441580.1_6 Forward -370 -351 -8.45701 0.262
NP_443055.1_6 Forward -207 -189 -1.6532 0.281
NP_440993.1_4 Reverse -368 -385 3.28376 0.289
NP_440934.1_4 Forward -41 -22 9.53756 0.187
NP_440602.1_2 Reverse -316 -335 1.57275 0.263
NP_441099.1_5 Forward -298 -279 -12.2919 0.299
NP_442002.1_9 Reverse -278 -285 12.4288 0.185
NP_442002.1_9 Forward -76 -69 11.3472 0.185
NP_441294.1_7 Reverse -317 -331 9.92255 0.219
NP_442438.1_10 Forward -293 -279 9.43936 0.0637
NP_441292.1_2 Forward -194 -175 -5.70374 0.241
NP_441000.1_5 Reverse -59 -78 8.06178 0.229
NP_442771.1_1 Reverse -366 -384 -0.0791831 0.102
NP_442771.1_1 Forward -379 -361 -2.24246 0.149
NP_440147.1_4 Reverse -277 -290 17.0305 0.00838
NP_440147.1_4 Forward -332 -319 -0.472371 0.287
NP_441041.1_4 Reverse -158 -177 -7.08038 0.181
NP_441041.1_7 Reverse -276 -288 8.09784 0.147
NP_441041.1_7 Forward -291 -279 7.80631 0.159
NP_442004.1_6 Reverse -116 -130 16.3225 0.0577
NP_441725.1_4 Reverse -345 -359 5.40719 0.278
NP_441725.1_5 Forward -287 -277 0.471689 0.173
NP_441725.1_5 Reverse -369 -379 -0.0199663 0.223
NP_441406.1_1 Reverse -297 -316 18.0924 0.221
NP_439966.1_7 Reverse -319 -329 7.45273 0.15
NP_442941.1_3 Reverse -322 -332 -0.0199663 0.244
NP_442941.1_3 Forward -329 -319 -1.10161 0.284
NP_440289.1_2 Forward -291 -278 1.9859 0.108
NP_440983.1_9 Reverse -341 -360 7.86593 0.241
NP_441678.1_9 Forward -94 -75 3.24438 0.218
NP_442281.1_1 Reverse -274 -288 16.6169 0.00772
NP_442281.1_1 Forward -49 -35 3.8339 0.217
NP_442901.1_4 Forward -141 -122 1.76941 0.278
NP_442068.1_4 Forward -281 -262 7.37347 0.23
NP_441644.1_6 Forward -330 -320 5.38779 0.194
NP_443049.1_6 Forward -96 -86 12.2265 0.24
NP_442215.1_2 Forward -290 -274 9.59664 0.0552
NP_441751.2_8 Forward -329 -315 -4.91696 0.187
NP_441751.2_8 Forward -287 -273 -6.49025 0.269
NP_442554.1_8 Forward -287 -277 2.33998 0.274
NP_441762.1_7 Forward -126 -114 -6.74586 0.284
NP_443009.1_5 Reverse -320 -331 13.4312 0.0327
NP_443009.1_5 Forward -331 -320 9.89126 0.0866
NP_443009.1_5 Forward -378 -367 7.03967 0.141
NP_440357.1_3 Forward -290 -271 -0.39387 0.295
NP_440730.1_4 Reverse -368 -387 -1.67217 0.28
NP_441448.1_1 Forward -365 -346 4.81767 0.27
NP_441198.1_8 Reverse -319 -329 15.6152 0.0427
NP_440379.1_5 Reverse -365 -384 -8.16202 0.25
NP_440379.1_5 Reverse -170 -189 -8.94866 0.257
NP_441020.2_6 Reverse -156 -173 7.90532 0.215
NP_441673.1_1 Forward -330 -321 1.27803 0.155
NP_441673.1_1 Reverse -321 -330 1.27803 0.155
NP_441673.1_1 Forward -288 -279 1.27803 0.155
NP_441673.1_1 Reverse -279 -288 1.27803 0.155
NP_442868.1_6 Reverse -319 -329 2.43831 0.205
NP_442719.1_3 Forward -114 -101 16.4399 0.292
NP_440051.1_5 Forward -40 -26 14.4488 0.285
NP_442227.1_4 Forward -313 -294 12.88 0.273
NP_442361.1_3 Reverse -74 -87 9.75405 0.272
NP_441101.1_10 Forward -334 -315 -6.68705 0.29
NP_442630.1_1 Reverse -369 -388 8.55425 0.296
NP_442630.1_5 Reverse -25 -44 12.2908 0.267
NP_440145.1_3 Forward -340 -321 -3.63879 0.206
NP_442050.1_5 Reverse -319 -329 11.7793 0.0832
NP_440601.1_4 Forward -333 -314 12.8808 0.298
NP_440558.1_2 Reverse -317 -336 -7.67036 0.298
NP_441878.1_6 Reverse -278 -288 1.25834 0.108
NP_441878.1_6 Forward -378 -368 -6.8048 0.196
NP_441878.1_6 Forward -331 -321 -7.49312 0.231
NP_441878.1_6 Forward -289 -279 -7.59145 0.245
NP_441878.1_6 Forward -348 -338 -7.98478 0.285
NP_441557.1_5 Forward -330 -321 0.393051 0.166
NP_441557.1_5 Forward -288 -279 0.393051 0.166
NP_441557.1_5 Reverse -321 -330 0.393051 0.166
NP_441557.1_5 Reverse -279 -288 0.393051 0.166
NP_441557.1_8 Forward -197 -187 15.8108 0.18
NP_441557.1_8 Forward -392 -382 14.8275 0.183
NP_441445.1_1 Forward -297 -278 2.55606 0.233
NP_441590.1_2 Reverse -375 -388 18.0139 0.295
NP_442066.2_4 Forward -143 -124 -9.24366 0.296
NP_442183.1_1 Forward -288 -274 7.37441 0.143
NP_442397.1_1 Forward -90 -76 13.8282 0.296
NP_441574.1_1 Forward -95 -76 -6.58872 0.277
NP_442347.1_2 Reverse -87 -96 16.421 0.056
NP_442347.1_2 Forward -162 -153 4.0313 0.284
NP_442645.1_2 Forward -296 -277 -4.32711 0.0562
NP_442645.1_2 Forward -222 -203 -20.7484 0.288
NP_441037.1_4 Reverse -360 -370 10.2414 0.21
NP_442594.1_8 Reverse -299 -318 1.67108 0.298
NP_442594.1_9 Reverse -99 -118 9.63507 0.228
NP_441633.1_3 Reverse -277 -290 -6.66722 0.265
NP_440136.1_2 Forward -329 -322 11.1505 0.0519
NP_440136.1_2 Forward -287 -280 3.97235 0.288
NP_442590.1_10 Reverse -138 -157 5.01433 0.267
NP_442590.1_10 Reverse -314 -333 4.22769 0.278
NP_442998.1_5 Forward -132 -122 9.61647 0.238
NP_442998.1_10 Forward -286 -279 9.28223 0.117
NP_441799.1_1 Reverse -317 -331 6.48882 0.17
NP_441799.1_1 Reverse -275 -289 5.80051 0.194
NP_442333.2_5 Forward -364 -345 -15.0452 0.288
NP_440256.1_1 Reverse -70 -89 -10.227 0.297
NP_440087.1_1 Reverse -180 -199 -1.86883 0.197
NP_441362.1_2 Reverse -54 -73 4.79121 0.263
NP_441559.1_8 Reverse -316 -330 11.406 0.0574
NP_441559.1_8 Forward -335 -321 9.5377 0.0639
NP_440915.1_6 Forward -292 -278 0.392915 0.165
NP_440915.1_6 Reverse -317 -331 -0.590395 0.202
NP_440915.1_6 Forward -334 -320 -1.77037 0.246
NP_442069.1_1 Forward -364 -345 19.7631 0.12
NP_442866.1_1 Reverse -315 -334 -8.85033 0.285
NP_441464.1_8 Reverse -279 -293 7.57108 0.206
NP_440695.1_5 Reverse -158 -177 4.03102 0.213
NP_440677.1_1 Reverse -270 -289 22.0256 0.0283
NP_440677.1_1 Reverse -146 -165 8.75091 0.203
NP_441750.1_1 Reverse -302 -321 -4.52377 0.204
NP_440327.1_6 Forward -94 -75 18.7807 0.0715
NP_441132.1_3 Reverse -145 -164 4.32602 0.281
NP_440586.1_8 Forward -52 -45 5.64364 0.297
NP_440586.1_8 Reverse -199 -206 5.64364 0.297
NP_442251.1_6 Forward -287 -280 9.67555 0.174
NP_443051.1_1 Reverse -320 -329 -0.000272808 0.245
NP_443051.1_1 Forward -331 -322 -0.000272808 0.245
NP_439937.1_8 Forward -97 -78 4.22769 0.2
NP_439937.1_8 Forward -262 -243 3.53937 0.204
NP_439937.1_9 Forward -331 -314 -8.31994 0.176
NP_440439.1_1 Reverse -151 -164 9.85238 0.0418
NP_440439.1_1 Forward -333 -320 8.9674 0.0488
NP_440439.1_1 Reverse -318 -331 -0.0790467 0.207
NP_440439.1_1 Reverse -380 -393 -0.37404 0.215
NP_442239.1_8 Forward -360 -341 4.52268 0.296
NP_440819.1_5 Forward -118 -110 15.8507 0.185
NP_440819.1_5 Forward -117 -109 7.68924 0.266
NP_440819.1_5 Forward -246 -238 7.59091 0.272
NP_442488.1_5 Reverse -156 -175 19.6656 0.0475
NP_442384.1_10 Forward -163 -150 3.85419 0.176
NP_442262.1_10 Forward -287 -280 8.8889 0.219
NP_442244.1_3 Forward -86 -67 4.81767 0.258
NP_440344.1_10 Reverse -272 -289 -11.6625 0.223
NP_440282.1_10 Forward -387 -368 -8.35868 0.262
NP_442693.1_6 Forward -384 -365 -0.688862 0.295
NP_440297.1_9 Reverse -369 -379 4.40493 0.231
NP_440350.1_5 Reverse -225 -244 -4.6221 0.281
NP_440894.1_10 Forward -262 -243 2.16274 0.294
NP_440999.1_9 Reverse -275 -289 -3.34366 0.291
NP_440888.1_2 Forward -330 -316 12.2903 0.0476
NP_440888.1_2 Reverse -279 -293 7.3738 0.198
NP_440491.1_1 Reverse -155 -174 7.50176 0.265
NP_440491.1_1 Forward -92 -73 7.20938 0.274
NP_442033.1_10 Reverse -319 -338 -1.96717 0.148
NP_441543.1_2 Reverse -351 -360 5.21127 0.209
NP_442845.1_2 Forward -257 -243 4.03116 0.271
NP_440982.1_1 Forward -198 -179 12.4867 0.156
NP_443064.1_6 Reverse -321 -331 8.78555 0.271
NP_442578.1_7 Reverse -159 -166 9.97054 0.112
NP_440710.1_1 Forward -191 -173 -7.65067 0.241
NP_441462.1_2 Reverse -321 -331 0.668351 0.135
NP_441462.1_2 Forward -330 -320 0.668351 0.135
NP_441462.1_2 Forward -288 -278 0.57002 0.144
NP_441621.1_4 Reverse -69 -82 14.9656 0.246
NP_443062.1_6 Reverse -271 -290 1.17943 0.278
NP_441601.1_2 Reverse -273 -292 -2.55715 0.273
NP_442204.1_1 Reverse -346 -357 -0.432984 0.299
NP_442487.1_2 Forward -274 -255 20.7464 0.0148
NP_442487.1_6 Forward -294 -275 16.9115 0.196
NP_442080.1_1 Forward -94 -75 14.0608 0.032
NP_440618.1_1 Forward -383 -364 -9.34199 0.292
NP_442120.1_10 Reverse -362 -381 -15.5368 0.294
NP_441867.1_2 Reverse -301 -320 -14.0619 0.277
NP_440673.1_2 Reverse -241 -260 9.31652 0.248
NP_441052.1_2 Reverse -350 -360 2.24165 0.213
NP_441052.1_2 Reverse -279 -289 1.16001 0.25
NP_442219.1_8 Forward -93 -74 7.29741 0.271
NP_441884.1_9 Reverse -276 -295 -22.8133 0.284
NP_441884.1_9 Forward -263 -244 -23.01 0.284
NP_441336.1_10 Reverse -76 -95 13.7658 0.179
NP_442907.1_9 Forward -382 -363 -6.68705 0.289
NP_441004.1_1 Reverse -303 -322 -10.9153 0.229
NP_441004.1_1 Reverse -326 -345 -11.5053 0.24
NP_441004.1_1 Reverse -302 -321 -17.5035 0.292
NP_441004.1_4 Reverse -71 -81 13.2547 0.216
NP_441004.1_4 Forward -85 -75 8.33817 0.277
NP_442308.1_4 Forward -294 -275 18.584 0.118
NP_441851.1_10 Forward -331 -321 5.5849 0.207
NP_441851.1_10 Forward -289 -279 4.89658 0.24
NP_442856.1_5 Forward -340 -321 17.5372 0.204
NP_440593.1_5 Forward -140 -121 18.289 0.194
NP_441349.1_10 Forward -340 -321 -5.99873 0.217
NP_442843.1_1 Reverse -243 -262 -11.6036 0.291
NP_441150.1_5 Reverse -241 -259 13.8838 0.27
NP_442006.1_2 Reverse -73 -90 -19.234 0.299
NP_441570.1_1 Reverse -368 -386 -9.12563 0.129
NP_441570.1_1 Reverse -80 -98 -15.5171 0.231
NP_441078.1_4 Reverse -321 -330 7.86621 0.0432
NP_441078.1_4 Reverse -279 -288 0.786375 0.157
NP_441078.1_4 Forward -330 -321 0.589713 0.174
NP_441078.1_4 Forward -288 -279 0.589713 0.174
NP_441078.1_4 Reverse -368 -377 -1.08191 0.222
NP_441078.1_4 Forward -377 -368 -1.86856 0.272
NP_442348.1_2 Forward -76 -67 6.5879 0.299
NP_440526.1_3 Reverse -280 -291 9.10461 0.0988
NP_441432.1_8 Reverse -320 -329 8.1612 0.0815
NP_442320.1_8 Reverse -362 -376 -4.52363 0.171
NP_441732.1_2 Forward -334 -318 -14.3961 0.145
NP_442010.1_9 Forward -200 -186 16.8135 0.175
NP_440713.1_4 Forward -363 -344 6.09597 0.196
NP_440713.1_4 Reverse -144 -163 6.09597 0.196
NP_440713.1_4 Reverse -148 -167 1.0811 0.294
NP_442489.1_7 Forward -330 -321 7.86621 0.0448
NP_442489.1_7 Forward -288 -279 7.86621 0.0448
NP_442489.1_7 Reverse -321 -330 0.589713 0.17
NP_442489.1_7 Reverse -279 -288 0.589713 0.17
NP_442489.1_7 Reverse -368 -377 -2.06522 0.288
NP_440559.1_1 Reverse -280 -289 4.32629 0.288
NP_441659.2_8 Reverse -321 -331 1.65166 0.233
NP_441659.2_8 Forward -330 -320 1.35667 0.242
NP_441659.2_8 Forward -288 -278 -0.216628 0.292
NP_441022.1_1 Reverse -103 -112 14.5198 0.183
NP_440363.1_9 Forward -356 -338 16.0471 0.187
NP_441040.1_2 Reverse -112 -131 -14.9469 0.286
NP_442776.1_6 Forward -290 -271 11.9958 0.165
NP_440779.1_5 Forward -371 -354 -14.7108 0.269
NP_442346.1_5 Reverse -278 -288 5.5849 0.238
NP_440545.1_3 Reverse -317 -334 -1.73112 0.173
NP_440545.1_3 Forward -334 -317 -3.99273 0.215
NP_440831.1_3 Reverse -145 -164 5.80468 0.28
NP_440486.1_6 Reverse -148 -167 14.3558 0.207
NP_440250.1_4 Reverse -93 -112 14.7483 0.156
NP_442551.1_4 Forward -290 -275 0.471552 0.245
NP_440224.1_1 Forward -341 -322 4.71934 0.132
NP_442821.1_2 Forward -52 -33 5.70265 0.177
NP_440875.1_9 Forward -351 -341 11.2921 0.175
NP_440875.1_9 Reverse -323 -333 8.76138 0.233
NP_440875.1_9 Reverse -88 -98 8.76138 0.233
NP_440590.1_4 Forward -329 -316 -5.97891 0.296
NP_440567.1_1 Reverse -280 -294 0.589577 0.24
NP_442497.1_10 Forward -287 -278 0.29472 0.199
NP_441239.1_9 Reverse -249 -261 4.16888 0.26
NP_441239.1_9 Reverse -319 -331 3.18557 0.292
NP_441017.1_6 Forward -264 -250 12.9786 0.209
NP_441017.1_8 Forward -291 -276 9.12468 0.231
NP_441769.1_3 Forward -42 -23 -7.47443 0.293
NP_440833.1_6 Reverse -64 -78 8.25877 0.277
NP_442809.1_6 Reverse -356 -375 0.58944 0.288
NP_440462.1_6 Forward -332 -322 7.15819 0.089
NP_440462.1_6 Forward -97 -87 2.53664 0.282
NP_440402.1_3 Reverse -7 -26 5.89931 0.276
NP_442402.1_4 Reverse -78 -97 -8.55607 0.283
NP_440696.1_3 Reverse -154 -172 -2.24246 0.274
NP_441843.2_9 Reverse -88 -106 15.6469 0.144
NP_442039.1_4 Forward -287 -280 10.5605 0.121
NP_442039.1_7 Reverse -76 -86 13.1564 0.212
NP_442039.1_7 Forward -249 -239 10.0098 0.257
NP_441811.1_8 Reverse -80 -94 6.6861 0.265
NP_441926.1_3 Reverse -321 -337 3.20513 0.236
NP_442837.1_3 Reverse -87 -94 6.52896 0.2
NP_442837.1_4 Reverse -75 -94 9.3409 0.233
NP_440160.1_2 Forward -348 -329 -8.94866 0.292
NP_439994.1_3 Forward -331 -312 8.73121 0.28
NP_442053.1_1 Forward -330 -321 5.21127 0.203
NP_442053.1_1 Reverse -279 -288 5.01461 0.213
NP_440505.1_3 Forward -332 -322 13.353 0.0331
NP_440505.1_3 Reverse -319 -329 10.4031 0.108
NP_440505.1_3 Reverse -381 -391 9.02648 0.128
NP_440505.1_3 Reverse -152 -162 6.56821 0.176
NP_440505.1_3 Forward -290 -280 4.50326 0.284
NP_440505.1_7 Reverse -380 -399 -2.45882 0.289
NP_441252.1_6 Forward -78 -71 14.3954 0.168
NP_442471.1_10 Forward -380 -361 9.0459 0.244
NP_440914.1_1 Reverse -321 -331 13.7874 0.0256
NP_440914.1_1 Reverse -279 -289 13.2019 0.0378
NP_440914.1_1 Reverse -74 -84 8.71269 0.186
NP_442101.1_10 Reverse -360 -379 -9.14533 0.245
NP_442533.1_1 Reverse -302 -321 -15.8318 0.257
NP_442533.1_6 Reverse -321 -330 7.96454 0.0838
NP_442533.1_6 Reverse -339 -348 3.63797 0.206
NP_442232.1_3 Forward -133 -114 -13.5702 0.282
NP_442229.1_1 Forward -290 -276 5.99717 0.242
NP_439944.1_9 Reverse -280 -290 5.78156 0.221
NP_442269.1_10 Forward -94 -75 11.1109 0.176
NP_441028.1_6 Reverse -87 -97 8.73102 0.216
NP_441028.1_6 Reverse -237 -247 6.76441 0.23
NP_441028.1_6 Forward -196 -186 4.10949 0.278
NP_441527.1_4 Forward -242 -223 -8.54695 0.247
NP_440115.1_6 Reverse -318 -328 12.3697 0.0987
NP_440115.1_6 Reverse -155 -165 4.69992 0.288
NP_439965.1_7 Reverse -88 -107 10.2223 0.294
NP_441961.1_4 Reverse -318 -337 3.34271 0.279
NP_441972.1_3 Reverse -178 -197 12.7825 0.257
NP_441106.1_1 Forward -267 -258 8.06287 0.0629
NP_442306.1_10 Reverse -316 -335 -21.83 0.291
NP_441286.1_1 Reverse -79 -91 -1.43599 0.145
NP_441286.1_1 Forward -289 -277 -4.09092 0.149
NP_440670.1_8 Forward -330 -321 5.40793 0.158
NP_440670.1_8 Forward -288 -279 5.40793 0.158
NP_440670.1_8 Reverse -279 -288 5.40793 0.158
NP_440670.1_8 Forward -207 -198 4.32629 0.199
NP_440886.1_7 Reverse -278 -288 3.61784 0.272
NP_440886.1_7 Reverse -367 -377 3.42118 0.282
NP_442072.1_9 Forward -331 -313 -11.9772 0.0799
NP_442072.1_9 Reverse -278 -296 -20.9253 0.204
NP_440907.2_8 Forward -329 -319 6.37109 0.171
NP_441463.1_2 Reverse -96 -114 0.851205 0.263
NP_441401.1_4 Forward -242 -229 13.4906 0.273
NP_442615.1_1 Reverse -270 -288 -6.4707 0.248
NP_441962.1_4 Forward -293 -274 -3.04881 0.141
NP_440387.1_1 Forward -330 -314 -1.61309 0.143
NP_440387.1_1 Forward -377 -361 -4.75968 0.198
NP_440387.1_1 Reverse -279 -295 -5.15301 0.217
NP_441431.1_3 Reverse -368 -387 5.40766 0.263
NP_441488.1_7 Forward -135 -116 8.35759 0.121
NP_441488.1_8 Forward -212 -198 9.43874 0.153
NP_441836.1_2 Reverse -373 -392 -4.6221 0.261
NP_441174.1_2 Forward -333 -319 15.2409 0.125
NP_440467.1_3 Reverse -369 -388 12.0375 0.252
NP_440114.1_10 Forward -330 -316 7.9644 0.219
NP_442698.1_10 Forward -247 -228 1.0811 0.297
NP_440293.1_3 Forward -337 -318 -5.80207 0.282
NP_439988.1_3 Forward -87 -73 4.52282 0.295
NP_441237.1_9 Forward -82 -72 10.8948 0.214
NP_442743.1_1 Forward -320 -301 11.7983 0.241
NP_442867.1_8 Forward -391 -372 13.4708 0.171
NP_442867.1_8 Reverse -141 -160 5.211 0.276
NP_440457.1_1 Reverse -185 -197 -0.452677 0.263
NP_442940.1_2 Forward -288 -269 1.0811 0.296
NP_441801.1_4 Forward -161 -151 2.92996 0.231
NP_442680.1_5 Forward -248 -229 1.14682 0.251
NP_440942.1_3 Reverse -262 -281 2.55606 0.298
NP_442509.1_9 Forward -207 -197 10.6976 0.163
NP_442936.1_10 Reverse -103 -117 8.97675 0.269
NP_442737.1_10 Reverse -94 -113 24.7839 0.00473
NP_441885.1_5 Reverse -279 -289 2.24165 0.0822
NP_441885.1_5 Reverse -321 -331 -0.0199663 0.186
NP_442341.1_7 Reverse -278 -292 4.91614 0.175
NP_442341.1_7 Forward -378 -364 4.32615 0.194
NP_441173.1_9 Forward -313 -305 10.9338 0.242
NP_441173.1_9 Reverse -124 -132 10.9338 0.242
NP_441173.1_9 Forward -56 -48 10.9338 0.242
NP_441173.1_9 Reverse -98 -106 9.85212 0.275
NP_443000.1_7 Forward -332 -322 0.963343 0.278
NP_440507.2_3 Reverse -248 -267 10.1267 0.208
NP_441561.1_4 Reverse -323 -342 7.57094 0.224
NP_441842.1_1 Forward -328 -315 14.8666 0.0877
NP_441842.1_10 Forward -295 -281 6.09611 0.299
NP_440091.1_1 Forward -292 -280 0.628964 0.241
NP_441122.1_1 Forward -218 -203 2.8315 0.294
NP_442495.1_5 Reverse -351 -370 7.57094 0.291
NP_442214.1_1 Forward -299 -280 10.9142 0.25
NP_440216.1_1 Reverse -321 -335 -4.32697 0.107
NP_440216.1_1 Forward -330 -316 -11.8985 0.228
NP_440216.1_9 Forward -249 -240 14.651 0.172
NP_440172.1_1 Reverse -279 -289 9.91146 0.0577
NP_440172.1_1 Reverse -321 -331 5.09324 0.153
NP_440172.1_1 Forward -330 -320 4.79825 0.166
NP_440172.1_1 Forward -288 -278 3.51995 0.224
NP_442379.1_10 Forward -295 -278 6.13536 0.118
NP_442379.1_10 Reverse -314 -331 -1.23946 0.223
NP_441766.1_2 Reverse -279 -288 3.93297 0.2
NP_440416.1_1 Reverse -321 -340 -4.52377 0.128
NP_442116.1_6 Forward -32 -15 6.54559 0.276
NP_440988.1_5 Forward -322 -303 13.2508 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCAAAGGAACCTACCCCCGGCAGGACAATAGCCGTAGCACCGTCGATAACGTGGGCCTGGTCCGTTACCAGGGGATTGCCTCCCACTTTCTCCAAACCCTTACAGACGGAGTGGAGATTGCCCATATCATAATCAACGACGGCGATGTAACCCATGGGAAAAAAGACGCAAAGTAGGACAGAGTTAGACCATTGATGATCGGACCTAACCCCCGTCTAGCCATTGTACGCAAAGTTGACCGCTCCCCAGGACGGACTAGCAATATCTCTGGGCAGAAGGATCCCGGAAAAAATCTTTGCTAAACCGGGGATCAAGTTCGCCATTGGGCAATTTTGATATTAGAATTCAGCCAACACACCAATTTCACTAATCTGTTGGCATTATTTGAGATTTGAGAACC

CDS

ATGGGGAATGAAAAAGCTAGAGTCGGTATCATTGGCGCGTCGGGCTATGGCGGCATTCAGCTAGTACGTTTATTGTTGGAACATCCCCAGGTGGAATTGACCTACCTAGCGGGGCACAGCAGTGCAGGCAAGCCCTACAGTGATCTTTATCCCCATTTAACCCACCGGGTAAACCTCACCATCGAACCCATTGACCTAGAGGCGATCGCCAGCCGTTGTGATGCGGTGTTCCTTGGTCTGCCCAATGGTTTAGCCTGTGACATGGCCCCGGCATTATTGGCCAAAGGTTGTAAAGTTTTAGATCTGTCGGCGGACTATCGTTTCCGCAATCTTAACACCTACACGGAATGGTACAAAAAGGATCGTCAGGACCAAGCCACCAATAACCAAGCTGTTTACGGCCTGCCGGAATTGTACCGGGATGCTATTAGGGATGCCCAACTAATTGGTTGCCCCGGCTGTTATCCCACCGCCAGTTTACTAGCCCTTTCCCCGTTGCTGAAACAGGGTTTCATTGTGCCCGAAACTGCCATTATTGACGCTAAGTCCGGTACTTCCGGGGGAGGTAGAGAGGCAAAAGTTAACATGCTCCTAGCAGAAGCAGAAGGATCTTTGGGGGCCTACGGAGTAGCTAAACACCGCCATACCCCTGAAATTGAACAGATTGCCAGTGATTTGGCCGGTACGGAGCTAAGGGTACAGTTCACGCCTCACTTGATCCCCATGGTGCGCGGTATCCTAGCCACCGTTTATGCCACCCTGCGGGATCCGGGTTTGGTGCGGGATGATCTGATCACCATTTACAGTGCTTTTTACCGGGCTTCCCCCTTTGTGAAAATTCTGCCCCACGGGGTTTACCCCCAAACGAAATGGGCTTGGGGGACGAATCTTTGCTACATTGGCATCGAAGTGGACCCCCGCACTGGGCGGGTAATTGTCCTTTCCGCCATTGATAATCTGGTCAAAGGCCAGGCAGGGCAGGCAGTGCAATGCTTAAACCTCATGATGGGTTGGGAAGAATCCTTAGGCTTGCCCCAACTGGCTTTTTATCCCTAG

Protein

MGNEKARVGIIGASGYGGIQLVRLLLEHPQVELTYLAGHSSAGKPYSDLYPHLTHRVNLTIEPIDLEAIASRCDAVFLGLPNGLACDMAPALLAKGCKVLDLSADYRFRNLNTYTEWYKKDRQDQATNNQAVYGLPELYRDAIRDAQLIGCPGCYPTASLLALSPLLKQGFIVPETAIIDAKSGTSGGGREAKVNMLLAEAEGSLGAYGVAKHRHTPEIEQIASDLAGTELRVQFTPHLIPMVRGILATVYATLRDPGLVRDDLITIYSAFYRASPFVKILPHGVYPQTKWAWGTNLCYIGIEVDPRTGRVIVLSAIDNLVKGQAGQAVQCLNLMMGWEESLGLPQLAFYP