Your browser is old and dusty. Try Google Chrome!

Details for sll0070

ORF sll0070
Accession NP_442200.1
Symbol purU
Category Purine ribonucleotide biosynthesis
Definition phosphoribosylglycinamide formyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442272.1_2 Forward -147 -128 20.6736 0.0501
NP_441453.1_7 Forward -78 -71 14.1988 0.175
NP_441623.1_1 Forward -182 -164 -1.45582 0.24
NP_440226.1_1 Forward -205 -186 2.3594 0.267
NP_442752.1_4 Forward -205 -198 4.26735 0.293
NP_443027.1_4 Forward -207 -197 10.0098 0.144
NP_440074.1_6 Reverse -105 -124 14.1583 0.268
NP_441093.1_3 Reverse -262 -281 16.2563 0.244
NP_441681.1_9 Reverse -365 -379 13.8643 0.19
NP_440061.1_9 Reverse -309 -323 6.29216 0.251
NP_440061.1_9 Forward -303 -289 5.50552 0.283
NP_440061.1_9 Forward -360 -346 4.91554 0.3
NP_442062.1_8 Forward -205 -195 4.89658 0.193
NP_442062.1_8 Forward -358 -348 2.83163 0.293
NP_441995.1_6 Reverse -221 -240 13.7658 0.286
NP_441859.1_3 Reverse -310 -329 1.86696 0.272
NP_441802.1_1 Reverse -262 -281 11.0125 0.197
NP_440304.1_4 Reverse -347 -357 5.28991 0.218
NP_442762.1_10 Forward -305 -286 -17.4051 0.293
NP_442097.1_2 Reverse -99 -118 1.17943 0.259
NP_439918.1_3 Reverse -349 -368 5.89931 0.264
NP_441208.1_9 Forward -46 -32 11.996 0.145
NP_441109.1_4 Forward -236 -217 15.1424 0.204
NP_442110.1_7 Reverse -226 -240 5.60446 0.168
NP_440856.1_4 Reverse -304 -323 0.0977854 0.17
NP_440856.1_7 Reverse -246 -265 6.68596 0.127
NP_440447.1_5 Forward -79 -69 15.418 0.277
NP_442398.1_4 Reverse -104 -123 12.88 0.147
NP_441713.1_3 Reverse -237 -256 10.2259 0.16
NP_441770.1_4 Reverse -350 -369 8.55425 0.101
NP_440178.1_7 Forward -44 -25 -20.945 0.204
NP_441716.1_1 Forward -358 -344 14.8476 0.0595
NP_442111.1_4 Reverse -264 -278 2.06454 0.291
NP_441163.1_1 Reverse -341 -358 4.75801 0.285
NP_442801.1_4 Reverse -84 -102 15.9488 0.245
NP_440747.1_10 Reverse -193 -205 -12.5474 0.297
NP_441486.1_1 Forward -361 -347 -1.96703 0.175
NP_441486.1_1 Forward -208 -194 -5.31028 0.231
NP_442330.1_9 Forward -242 -223 11.7008 0.184
NP_440842.1_6 Reverse -263 -282 10.2251 0.289
NP_441012.1_4 Forward -199 -186 6.90245 0.276
NP_443018.1_3 Reverse -175 -182 9.38056 0.128
NP_440376.1_1 Forward -320 -311 0.589713 0.267
NP_441002.1_3 Reverse -135 -154 9.04509 0.293
NP_441588.1_4 Reverse -176 -186 5.78156 0.235
NP_442589.1_1 Forward -238 -219 17.6007 0.179
NP_440141.1_8 Forward -67 -48 7.17762 0.246
NP_441971.1_5 Forward -301 -282 12.0942 0.234
NP_442205.1_9 Forward -211 -195 1.14018 0.255
NP_440656.1_8 Forward -369 -350 -1.7705 0.184
NP_441256.1_1 Reverse -234 -253 -9.83364 0.296
NP_441958.1_5 Forward -321 -311 -2.37991 0.272
NP_440203.1_5 Forward -355 -345 11.2876 0.2
NP_440153.1_5 Reverse -197 -211 2.2612 0.231
NP_442571.1_9 Reverse -67 -86 20.7473 0.0397
NP_443055.1_3 Forward -366 -347 11.3136 0.26
NP_443044.1_1 Forward -365 -346 9.53756 0.217
NP_442002.1_9 Reverse -264 -271 12.4288 0.185
NP_442002.1_9 Forward -118 -111 11.1505 0.185
NP_442002.1_9 Forward -206 -199 10.7572 0.185
NP_440147.1_4 Forward -45 -32 1.29759 0.233
NP_441916.1_7 Reverse -196 -206 6.07655 0.108
NP_441725.1_5 Forward -357 -347 7.05986 0.106
NP_442941.1_3 Forward -204 -194 4.40493 0.14
NP_440289.1_2 Forward -361 -348 -5.09393 0.297
NP_440260.1_8 Reverse -224 -242 -5.68405 0.276
NP_441079.1_7 Reverse -123 -142 2.55527 0.177
NP_442847.1_3 Forward -305 -286 8.4551 0.235
NP_440437.1_1 Reverse -190 -209 1.76941 0.143
NP_440437.1_1 Reverse -240 -259 -0.000545616 0.173
NP_440437.1_1 Forward -267 -248 -5.9004 0.296
NP_440647.1_9 Reverse -236 -254 4.14905 0.257
NP_442288.1_3 Reverse -167 -184 5.74204 0.284
NP_442029.1_1 Reverse -337 -356 -19.3717 0.288
NP_440253.1_2 Reverse -349 -367 -3.32411 0.291
NP_442933.1_2 Forward -150 -132 8.30978 0.257
NP_442933.1_5 Forward -379 -360 17.6007 0.0806
NP_442933.1_10 Reverse -196 -205 11.5045 0.042
NP_442554.1_8 Forward -182 -172 2.33998 0.274
NP_440919.1_9 Forward -261 -242 16.4207 0.124
NP_442406.1_9 Forward -60 -41 1.0811 0.274
NP_441715.1_4 Forward -204 -194 6.37155 0.148
NP_440379.1_5 Reverse -288 -307 1.76941 0.154
NP_439939.1_4 Reverse -104 -123 -2.0655 0.29
NP_441172.1_1 Forward -241 -223 0.904127 0.282
NP_441330.1_1 Forward -252 -233 9.83255 0.0252
NP_441637.1_9 Reverse -137 -155 -3.6191 0.296
NP_442719.1_2 Forward -114 -96 -8.92966 0.258
NP_441612.1_2 Forward -205 -195 9.61423 0.21
NP_442427.1_5 Forward -358 -339 10.3242 0.148
NP_442808.1_1 Forward -359 -349 5.28945 0.162
NP_442808.1_1 Forward -238 -228 1.94622 0.281
NP_440918.1_2 Forward -303 -284 11.2092 0.259
NP_440145.1_3 Reverse -24 -43 -1.18052 0.148
NP_442903.1_2 Forward -159 -140 5.77684 0.191
NP_441114.1_3 Forward -356 -347 7.57121 0.231
NP_440558.1_2 Reverse -288 -307 -0.0988766 0.198
NP_441878.1_6 Reverse -348 -358 2.33998 0.0405
NP_441878.1_6 Reverse -377 -387 -7.29646 0.217
NP_441878.1_6 Forward -301 -291 -7.88644 0.278
NP_441878.1_8 Forward -263 -249 18.8791 0.184
NP_441557.1_5 Forward -205 -196 -0.786921 0.239
NP_442267.1_4 Forward -302 -283 7.37428 0.158
NP_440101.1_3 Forward -210 -191 3.73603 0.224
NP_442192.1_8 Reverse -281 -300 11.0125 0.259
NP_442397.1_9 Reverse -285 -304 1.17943 0.291
NP_441116.1_9 Forward -176 -162 18.5841 0.111
NP_441574.1_1 Forward -195 -176 -5.40875 0.26
NP_441549.1_9 Forward -241 -223 -9.81395 0.261
NP_441467.1_10 Reverse -138 -152 9.93102 0.281
NP_442347.1_2 Reverse -197 -206 13.1761 0.056
NP_442347.1_2 Reverse -247 -256 4.81794 0.257
NP_442764.1_6 Forward -313 -295 1.39578 0.279
NP_442998.1_5 Reverse -96 -106 14.7297 0.149
NP_442998.1_5 Forward -119 -109 12.9597 0.158
NP_442998.1_10 Reverse -198 -205 5.93897 0.206
NP_442201.1_3 Reverse -3 -22 19.9598 0.0601
NP_441559.1_8 Reverse -57 -71 -7.57189 0.295
NP_442452.1_3 Reverse -361 -380 2.26107 0.281
NP_442866.1_1 Forward -260 -241 -9.83364 0.3
NP_442993.1_1 Reverse -349 -365 -9.18458 0.179
NP_442386.1_10 Forward -302 -289 3.46087 0.273
NP_442240.1_2 Reverse -197 -216 6.19431 0.0292
NP_442714.1_7 Reverse -115 -134 0.982764 0.226
NP_440586.1_8 Forward -204 -197 12.6251 0.0546
NP_440586.1_8 Forward -254 -247 10.7568 0.128
NP_441861.1_7 Forward -363 -344 18.0924 0.103
NP_440027.1_8 Forward -282 -263 4.12856 0.292
NP_439937.1_9 Forward -359 -342 -9.7949 0.209
NP_439937.1_9 Reverse -356 -373 -11.0732 0.241
NP_442294.1_3 Forward -194 -180 13.372 0.269
NP_441595.1_2 Reverse -159 -172 9.61097 0.277
NP_440271.1_2 Reverse -340 -359 5.99764 0.23
NP_440171.1_3 Forward -74 -55 3.24438 0.284
NP_440267.1_2 Forward -279 -265 12.9786 0.125
NP_442384.1_10 Reverse -196 -209 4.34585 0.16
NP_442384.1_10 Reverse -378 -391 2.96921 0.206
NP_441018.1_7 Forward -283 -264 7.57094 0.269
NP_442262.1_10 Reverse -175 -182 9.47889 0.187
NP_440189.1_10 Reverse -189 -208 2.45773 0.293
NP_440297.1_9 Forward -357 -347 6.96153 0.161
NP_440100.1_3 Forward -254 -235 -2.45882 0.221
NP_440350.1_5 Reverse -137 -156 1.96607 0.158
NP_440350.1_5 Reverse -136 -155 -7.08038 0.299
NP_442280.1_10 Forward -37 -19 5.25962 0.289
NP_441592.1_4 Reverse -292 -311 2.85105 0.186
NP_441592.1_4 Reverse -174 -193 -0.590531 0.244
NP_440894.1_10 Forward -25 -6 4.916 0.241
NP_443036.1_1 Reverse -66 -85 13.7649 0.224
NP_440888.1_4 Reverse -336 -350 18.9568 0.129
NP_440600.1_4 Reverse -166 -184 -0.472507 0.154
NP_442871.1_7 Reverse -335 -354 8.45592 0.299
NP_440575.1_1 Forward -114 -95 9.34008 0.191
NP_441543.1_2 Forward -204 -195 8.94785 0.0968
NP_442845.1_2 Forward -189 -175 15.1426 0.0752
NP_442710.1_7 Forward -144 -125 -6.06943 0.294
NP_442578.1_7 Forward -204 -197 12.6255 0.0418
NP_440668.1_2 Reverse -262 -281 9.0459 0.292
NP_443062.1_6 Reverse -341 -360 3.04771 0.245
NP_440889.1_8 Reverse -364 -383 22.2223 0.0438
NP_440911.1_9 Reverse -354 -373 3.73603 0.294
NP_441560.1_3 Reverse -256 -274 4.83737 0.298
NP_441867.1_2 Reverse -89 -108 -13.3736 0.277
NP_440673.1_3 Reverse -198 -205 10.1672 0.149
NP_440673.1_3 Forward -356 -349 8.98723 0.203
NP_440673.1_3 Forward -272 -265 7.51227 0.252
NP_441052.1_2 Reverse -246 -256 5.28991 0.124
NP_441052.1_2 Forward -205 -195 3.71661 0.175
NP_441052.1_2 Reverse -378 -388 1.84832 0.225
NP_441336.1_3 Forward -326 -312 15.5359 0.264
NP_441719.1_4 Forward -204 -197 3.77569 0.285
NP_439949.1_7 Forward -119 -105 14.9459 0.215
NP_442694.1_4 Forward -321 -312 14.1594 0.2
NP_442694.1_9 Forward -125 -106 8.75091 0.272
NP_443054.1_2 Reverse -347 -361 5.30946 0.237
NP_441851.1_10 Forward -206 -196 3.91327 0.296
NP_441668.1_5 Reverse -95 -114 9.93088 0.225
NP_441668.1_5 Reverse -96 -115 8.16093 0.242
NP_442515.1_8 Forward -227 -209 13.4905 0.275
NP_441396.1_5 Reverse -340 -349 8.45619 0.224
NP_440593.1_3 Reverse -286 -305 1.86774 0.183
NP_442843.1_1 Forward -182 -163 -0.197208 0.181
NP_442843.1_1 Reverse -349 -368 -3.3438 0.222
NP_442843.1_1 Reverse -175 -194 -7.86702 0.252
NP_442944.1_10 Reverse -318 -337 6.19431 0.281
NP_440396.1_1 Forward -270 -251 -5.50708 0.272
NP_440431.1_3 Forward -248 -229 -0.295539 0.142
NP_440431.1_4 Forward -157 -138 -2.91293 0.224
NP_442450.1_5 Reverse -244 -254 5.5849 0.237
NP_440954.1_3 Reverse -365 -384 14.1591 0.0306
NP_441003.1_9 Reverse -282 -301 5.60432 0.261
NP_440078.1_4 Forward -305 -286 12.9791 0.19
NP_441078.1_4 Forward -43 -34 -1.47524 0.266
NP_441078.1_4 Reverse -349 -358 -1.57357 0.266
NP_442729.1_5 Forward -184 -174 12.7631 0.235
NP_442348.1_2 Reverse -75 -84 14.7494 0.146
NP_442443.1_1 Reverse -350 -369 -6.39206 0.294
NP_443024.1_2 Reverse -165 -178 16.9316 0.167
NP_441732.1_2 Forward -239 -223 -16.1661 0.165
NP_442447.1_1 Reverse -90 -109 6.68596 0.258
NP_440313.1_5 Reverse -173 -191 12.8014 0.23
NP_442540.1_5 Reverse -292 -311 12.6833 0.233
NP_440199.1_4 Reverse -126 -144 13.2754 0.254
NP_440199.1_10 Forward -208 -198 11.3864 0.159
NP_442727.1_1 Forward -379 -365 12.6843 0.256
NP_442489.1_7 Forward -358 -349 4.91628 0.0892
NP_442489.1_7 Reverse -349 -358 -1.57357 0.213
NP_440559.1_1 Forward -204 -195 4.71961 0.217
NP_442749.1_5 Forward -125 -108 14.683 0.159
NP_442776.1_1 Reverse -292 -311 3.24438 0.29
NP_442776.1_2 Reverse -336 -355 10.8159 0.258
NP_442346.1_5 Reverse -251 -261 5.68323 0.234
NP_442346.1_5 Reverse -348 -358 5.28991 0.253
NP_440545.1_3 Forward -304 -287 -1.43612 0.168
NP_442934.1_9 Forward -154 -136 14.0805 0.282
NP_442070.1_1 Reverse -221 -240 13.7658 0.207
NP_441329.1_6 Forward -58 -39 -3.10391 0.296
NP_441973.1_1 Forward -102 -87 0.963207 0.235
NP_442140.1_3 Reverse -175 -185 5.09324 0.227
NP_440821.1_4 Forward -207 -197 -0.41329 0.257
NP_441239.1_9 Reverse -289 -301 9.28209 0.11
NP_441239.1_9 Reverse -172 -184 5.54551 0.217
NP_441892.1_1 Reverse -256 -273 2.49712 0.14
NP_441892.1_1 Forward -309 -292 -5.46769 0.281
NP_442044.1_1 Forward -240 -221 -11.6036 0.271
NP_442193.1_8 Reverse -283 -302 13.8633 0.211
NP_441874.1_1 Forward -128 -114 8.55439 0.298
NP_440833.1_6 Reverse -106 -120 6.78381 0.296
NP_440546.1_4 Forward -183 -173 14.2152 0.0459
NP_441230.1_5 Forward -252 -233 -0.39387 0.285
NP_440462.1_6 Forward -207 -197 2.43831 0.287
NP_440868.1_4 Forward -209 -197 1.02229 0.193
NP_441204.1_1 Forward -310 -291 7.66927 0.25
NP_442499.1_1 Forward -254 -235 4.22769 0.244
NP_442787.1_9 Forward -327 -308 12.7825 0.296
NP_441582.1_5 Forward -360 -341 3.73524 0.259
NP_442402.1_10 Forward -105 -95 10.1076 0.3
NP_441848.1_4 Forward -124 -108 13.1847 0.195
NP_441848.1_4 Forward -151 -135 8.60108 0.288
NP_441848.1_10 Forward -174 -161 17.058 0.196
NP_440696.1_3 Forward -397 -379 1.29745 0.217
NP_442039.1_7 Forward -77 -67 10.9931 0.257
NP_442679.1_1 Forward -156 -137 13.1758 0.0845
NP_440825.1_7 Forward -273 -263 11.2506 0.258
NP_442837.1_3 Reverse -197 -204 9.87221 0.106
NP_439994.1_3 Forward -206 -187 12.9259 0.139
NP_442533.1_6 Reverse -292 -301 10.2261 0.0558
NP_442533.1_6 Forward -205 -196 2.85133 0.236
NP_442533.1_6 Reverse -174 -183 1.67135 0.293
NP_442541.1_10 Forward -301 -287 2.94893 0.254
NP_442541.1_10 Reverse -291 -305 1.5723 0.283
NP_442269.1_10 Forward -194 -175 4.12936 0.248
NP_440816.1_2 Reverse -95 -114 11.082 0.202
NP_440816.1_2 Reverse -94 -113 5.66045 0.296
NP_441028.1_6 Forward -353 -343 12.9592 0.166
NP_441028.1_6 Forward -104 -94 7.45273 0.229
NP_440116.1_8 Forward -319 -300 -6.1954 0.204
NP_441527.1_4 Forward -153 -134 -5.5867 0.204
NP_441527.1_4 Forward -162 -143 -11.6982 0.284
NP_441527.1_4 Forward -58 -39 -12.9396 0.296
NP_440115.1_6 Forward -258 -248 5.68323 0.227
NP_440115.1_6 Reverse -262 -272 4.69992 0.288
NP_441680.1_4 Reverse -60 -79 -2.26216 0.267
NP_443045.1_5 Forward -325 -312 17.0692 0.119
NP_441825.1_4 Forward -192 -182 16.7946 0.186
NP_442306.1_10 Reverse -306 -325 -14.3569 0.197
NP_441286.1_1 Forward -256 -244 -6.05754 0.245
NP_442674.1_2 Reverse -119 -138 7.86593 0.262
NP_441385.1_1 Forward -328 -313 14.7295 0.28
NP_441479.1_1 Reverse -274 -293 10.0292 0.211
NP_440083.1_9 Forward -122 -103 11.1637 0.281
NP_442382.1_9 Reverse -46 -65 8.84842 0.281
NP_440404.1_9 Forward -152 -133 14.4666 0.175
NP_441993.1_1 Forward -326 -307 9.4509 0.136
NP_442084.1_6 Reverse -330 -348 4.6407 0.281
NP_440114.1_10 Forward -183 -169 7.27608 0.239
NP_440293.1_3 Forward -308 -289 20.944 0.0271
NP_440766.1_5 Forward -90 -78 11.9529 0.25
NP_442743.1_4 Reverse -197 -216 -7.17871 0.279
NP_442930.1_1 Forward -107 -97 9.71433 0.28
NP_440457.1_1 Reverse -345 -357 8.6921 0.101
NP_441801.1_4 Reverse -315 -325 2.63497 0.29
NP_442680.1_5 Reverse -93 -112 5.73827 0.216
NP_442680.1_5 Forward -157 -138 -0.416223 0.284
NP_441489.1_3 Forward -92 -78 11.5661 0.221
NP_442514.1_5 Reverse -284 -303 10.2251 0.0744
NP_441885.1_5 Forward -205 -195 0.766681 0.123
NP_441173.1_9 Forward -103 -95 13.1954 0.184
NP_440750.1_4 Forward -119 -100 9.83255 0.188
NP_443000.1_7 Reverse -194 -204 6.56821 0.123
NP_441842.1_10 Forward -327 -313 6.19444 0.297
NP_442932.1_10 Forward -272 -253 7.07928 0.249
NP_442638.1_3 Reverse -94 -113 13.3207 0.298
NP_441207.1_7 Reverse -97 -111 12.547 0.241
NP_439951.1_3 Reverse -82 -99 10.7569 0.243
NP_442495.1_4 Forward -80 -70 16.9913 0.0771
NP_442495.1_4 Forward -329 -319 13.7464 0.187
NP_441105.1_3 Forward -331 -312 -8.06369 0.265
NP_440216.1_9 Reverse -176 -185 7.37455 0.286
NP_440172.1_1 Forward -205 -195 4.69992 0.171
NP_441135.1_3 Forward -73 -54 8.45592 0.27
NP_441940.1_2 Forward -305 -286 18.6823 0.112
NP_442403.1_8 Reverse -248 -267 0.491109 0.241
NP_440988.1_5 Reverse -163 -182 15.2 0.202
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAGGTCTTGGTTGGCCTTAACCCTTTTTTGTGCGGCAAAACGTCCATTGCCCTCCATCAATTCCGTTAAAAGTTGCTGGGGCGTTTGGTTAGCAGACTGGGCCTGGGCAGCCGGGTTACCAGCCATTTGATTGCCCAGTATGGTGGCCATCAAGCTAGTGCCGAGGAAAGCTCCGCCATATTGGATTAACTGACGGCGATCAATAGTAGGGATTTTAGCCATGGGGTAATTTAGCTGAGTATCAGGAAGAACAACTAAAAAAACTGAGGTATTTTGAGTTAGGGCAAATTTTTCAATTTTCCCCATCATAGTCAGAAAAATTCCCTGGGGGCACTAAGTGGGAAAATGACAAGGTGGACTATCGTCTCATATTCCTAGGGCTGTATTCCTTTGTCTTTG

CDS

ATGCAAAATCTCACCGCAACACTGCTTGTTTCCTGTCCTGACCAACCGGGCATTGTGGCCCAAATTGCCCAGTTTATTTATCAAAACCAGGGCAATATTATCCATGCCGACCAGCACACGGACTTCTCCAGTGGACTTTTTTTAAATCGGGTGGAGTGGCAGTTGGACAATTTTCGCCTATCCCGTCCGGAGTTGTTATCCGCTTGGTCCCAATTGGCTGAGCAACTCCAAGCTACTTGGCAAATTCATTTTTCTGACCAGTTGCCCCGGTTAGCCCTCTGGGTGTCCAAGCAAGACCATTGTCTGCTCGATATTCTCTGGCGTTGGCGATCGGGAGAGTTGCGTTGTGAAATTCCCCTCATTATTAGTAATCATCCTGACCTCAAATCCATTGCTGACCAATTTGGCATTGATTTCCATTGTTTACCCATTACGAAAGAGAATAAATTAGCTCAGGAAACGGCCGAATTGGCTTTGTTGAAACAGTACCAAATTGATCTAGTGGTGTTAGCAAAATATCTACAAATTTTAACCACGGATTTTGTGGTTCAATTTCCCAACATTATTAATATTCACCACTCTTTTTTACCGGCTTTTCCCGGCGCTAATCCCTACCATCGTGCCCATGAGCGGGGCGTAAAAATCATTGGAGCCACCGCCCACTATGCCACCGCCCAATTGGATGAGGGTCCAATTATCGAGCAGGATGTGGTCAGGGTTAGTCACCGGGATAATGTGGACGATTTAATTCGTAAGGGAAGAGATTTAGAAAGGGTGGTGCTGGCTAGGGCCGTGCGTTTACATTTGCAACATCGAATTCTTGTTTATGATAACCGCACTGTGGTGTTTGCTTAA

Protein

MQNLTATLLVSCPDQPGIVAQIAQFIYQNQGNIIHADQHTDFSSGLFLNRVEWQLDNFRLSRPELLSAWSQLAEQLQATWQIHFSDQLPRLALWVSKQDHCLLDILWRWRSGELRCEIPLIISNHPDLKSIADQFGIDFHCLPITKENKLAQETAELALLKQYQIDLVVLAKYLQILTTDFVVQFPNIINIHHSFLPAFPGANPYHRAHERGVKIIGATAHYATAQLDEGPIIEQDVVRVSHRDNVDDLIRKGRDLERVVLARAVRLHLQHRILVYDNRTVVFA