Your browser is old and dusty. Try Google Chrome!

Details for sll0069

ORF sll0069
Accession NP_442202.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -169 -155 0.589577 0.205
NP_441061.1_2 Forward -155 -141 -0.197071 0.223
NP_440795.1_7 Reverse -237 -244 7.51227 0.24
NP_440795.1_7 Forward -140 -133 6.43063 0.265
NP_441418.1_6 Forward -156 -137 -29.0082 0.215
NP_441418.1_6 Reverse -147 -166 -29.6965 0.234
NP_441453.1_4 Reverse -147 -155 6.80426 0.121
NP_441453.1_4 Forward -156 -148 6.11594 0.121
NP_441453.1_4 Reverse -297 -305 4.83764 0.237
NP_442151.1_6 Reverse -147 -161 11.8976 0.0886
NP_441818.1_1 Forward -155 -144 15.2011 0.0343
NP_440226.1_1 Forward -156 -137 9.63589 0.0703
NP_441630.1_3 Reverse -139 -158 9.0459 0.103
NP_441630.1_3 Forward -164 -145 1.27776 0.251
NP_442173.1_1 Forward -155 -147 12.0158 0.0316
NP_442173.1_1 Reverse -148 -156 4.83764 0.241
NP_442752.1_4 Reverse -147 -154 13.8055 0.0199
NP_442752.1_4 Reverse -202 -209 9.47889 0.109
NP_443027.1_4 Reverse -234 -244 9.61647 0.159
NP_441812.1_3 Forward -324 -310 9.14437 0.245
NP_442975.1_10 Forward -70 -56 2.65393 0.269
NP_442975.1_10 Forward -160 -146 1.86729 0.29
NP_440784.1_7 Reverse -148 -155 6.23397 0.241
NP_440784.1_7 Forward -155 -148 6.13563 0.241
NP_441250.1_1 Forward -332 -313 17.2317 0.215
NP_440061.1_9 Forward -166 -152 11.7987 0.105
NP_441054.1_4 Forward -148 -130 -3.52077 0.272
NP_441594.1_6 Forward -78 -59 8.45592 0.153
NP_442110.1_7 Forward -170 -156 5.30946 0.175
NP_442726.1_7 Reverse -59 -77 12.8022 0.115
NP_441925.1_4 Reverse -122 -141 -13.5709 0.257
NP_440856.1_7 Reverse -129 -148 -7.57203 0.252
NP_441083.1_5 Forward -156 -146 17.7779 0.00336
NP_441083.1_5 Reverse -147 -157 7.05986 0.067
NP_442827.1_8 Reverse -228 -247 1.17865 0.185
NP_441738.1_2 Forward -154 -147 15.28 0.0102
NP_440209.1_1 Reverse -147 -155 8.57422 0.0425
NP_440209.1_1 Forward -156 -148 5.52596 0.0821
NP_442889.1_8 Forward -159 -145 4.52221 0.263
NP_441713.1_1 Forward -145 -126 -8.16202 0.145
NP_440178.1_7 Forward -157 -138 -15.7335 0.163
NP_440906.1_5 Reverse -298 -305 8.79057 0.149
NP_440906.1_5 Reverse -148 -155 6.23397 0.234
NP_440906.1_5 Forward -155 -148 6.13563 0.241
NP_442596.1_1 Reverse -148 -162 17.1085 0.294
NP_440747.1_10 Reverse -144 -156 -11.9574 0.178
NP_441130.1_10 Forward -158 -144 5.60446 0.223
NP_441486.1_1 Reverse -144 -158 -3.24533 0.177
NP_441486.1_1 Reverse -294 -308 -5.90027 0.266
NP_442634.1_4 Reverse -234 -248 -3.24533 0.161
NP_441265.1_3 Forward -162 -148 3.14618 0.181
NP_440403.1_4 Forward -223 -204 -0.787193 0.17
NP_440842.1_10 Forward -159 -145 2.16287 0.277
NP_441014.1_8 Forward -163 -144 0.491109 0.218
NP_441014.1_10 Reverse -65 -84 3.53858 0.213
NP_442848.1_1 Reverse -141 -155 -3.147 0.263
NP_441012.1_4 Reverse -62 -75 6.21414 0.284
NP_443018.1_3 Forward -155 -148 11.7405 0.0655
NP_443018.1_3 Reverse -156 -163 10.2655 0.107
NP_443018.1_3 Reverse -148 -155 5.44732 0.193
NP_441634.1_9 Forward -151 -132 10.52 0.252
NP_440376.1_1 Reverse -147 -156 5.99792 0.111
NP_440376.1_1 Reverse -236 -245 3.93297 0.188
NP_440376.1_1 Reverse -130 -139 3.63797 0.2
NP_440376.1_1 Forward -156 -147 -0.196935 0.285
NP_441588.1_4 Forward -154 -144 8.63316 0.14
NP_442687.1_7 Forward -157 -147 5.97822 0.179
NP_440642.1_10 Forward -165 -151 2.26061 0.281
NP_440042.1_2 Forward -166 -147 1.0811 0.213
NP_441763.1_10 Forward -137 -118 6.68515 0.266
NP_442658.1_1 Forward -158 -148 5.87944 0.246
NP_440141.1_8 Forward -268 -249 4.52268 0.288
NP_441855.2_4 Forward -100 -81 10.3907 0.255
NP_441855.2_4 Forward -164 -145 9.23384 0.286
NP_442782.1_2 Reverse -330 -344 1.08123 0.282
NP_442782.1_2 Forward -181 -167 0.491246 0.289
NP_442205.1_9 Reverse -230 -246 7.04003 0.109
NP_442205.1_9 Reverse -201 -217 4.58176 0.149
NP_440656.1_8 Reverse -136 -155 -8.45701 0.273
NP_442300.1_1 Forward -184 -165 10.8159 0.174
NP_441958.1_5 Reverse -146 -156 0.865012 0.12
NP_441958.1_5 Forward -157 -147 0.865012 0.12
NP_440984.1_7 Forward -161 -147 7.27608 0.178
NP_440153.1_5 Forward -244 -230 1.86788 0.245
NP_440153.1_5 Reverse -118 -132 1.08123 0.276
NP_440153.1_8 Reverse -126 -139 -2.53732 0.244
NP_443055.1_6 Reverse -147 -165 3.55831 0.195
NP_441099.1_5 Forward -166 -147 -7.86702 0.181
NP_442438.1_10 Forward -74 -60 0.687908 0.218
NP_441563.1_6 Reverse -81 -100 14.5524 0.13
NP_441000.1_5 Reverse -174 -193 5.60352 0.251
NP_441000.1_6 Forward -157 -143 3.8345 0.104
NP_441110.1_1 Reverse -144 -163 2.26107 0.297
NP_442884.1_2 Reverse -173 -192 20.2556 0.133
NP_440147.1_4 Reverse -145 -158 0.707601 0.247
NP_441550.1_8 Forward -158 -148 15.2208 0.0132
NP_441550.1_8 Reverse -145 -155 11.091 0.0555
NP_441916.1_7 Reverse -297 -307 2.7333 0.243
NP_441041.1_4 Forward -156 -137 -13.6686 0.293
NP_440569.1_6 Reverse -326 -345 10.7175 0.153
NP_440569.1_10 Reverse -171 -190 8.25963 0.231
NP_441725.1_5 Reverse -148 -158 7.05986 0.106
NP_441725.1_5 Forward -155 -145 1.455 0.135
NP_439966.1_7 Forward -158 -148 7.84605 0.149
NP_439966.1_7 Reverse -145 -155 6.0761 0.195
NP_440736.1_6 Reverse -130 -149 13.9625 0.217
NP_442941.1_3 Forward -155 -145 10.1081 0.024
NP_442941.1_3 Reverse -237 -247 5.38824 0.115
NP_440674.1_7 Reverse -124 -143 10.1267 0.276
NP_440289.1_2 Reverse -144 -157 5.13249 0.0636
NP_440289.1_2 Forward -159 -146 1.19926 0.135
NP_440289.1_2 Forward -311 -298 -3.02898 0.263
NP_441554.1_4 Reverse -222 -236 17.385 0.22
NP_441678.1_9 Forward -193 -174 -5.60541 0.297
NP_442256.1_2 Forward -158 -140 0.21581 0.126
NP_442982.1_5 Reverse -95 -114 16.1257 0.0748
NP_442982.1_5 Forward -255 -236 8.16093 0.12
NP_442982.1_5 Reverse -226 -245 7.86593 0.12
NP_441644.1_6 Forward -156 -146 14.4342 0.0126
NP_441644.1_6 Reverse -236 -246 4.40448 0.239
NP_443049.1_6 Reverse -146 -156 14.4711 0.114
NP_442215.1_2 Forward -173 -157 -3.57971 0.218
NP_442029.1_6 Forward -147 -128 5.11266 0.255
NP_442029.1_10 Forward -185 -166 10.0292 0.211
NP_440253.1_2 Forward -156 -138 3.16574 0.122
NP_440929.1_8 Forward -156 -147 7.07956 0.0713
NP_441751.2_8 Forward -155 -141 -3.93365 0.157
NP_442554.1_8 Forward -155 -145 6.07655 0.126
NP_442554.1_8 Reverse -148 -158 5.09324 0.161
NP_442554.1_8 Forward -163 -153 3.12662 0.239
NP_441762.1_7 Reverse -146 -158 -5.07423 0.187
NP_441762.1_7 Forward -307 -295 -6.64753 0.284
NP_442292.1_1 Forward -155 -146 8.65285 0.0335
NP_442476.1_6 Reverse -83 -97 7.37441 0.114
NP_443009.1_5 Forward -369 -358 10.5796 0.0792
NP_443009.1_5 Forward -246 -235 8.80962 0.099
NP_443009.1_5 Forward -307 -296 5.17139 0.214
NP_442092.1_4 Reverse -364 -383 16.4199 0.227
NP_441371.1_3 Forward -301 -283 4.14905 0.296
NP_441715.1_4 Forward -155 -145 4.99491 0.24
NP_440158.1_8 Reverse -185 -204 8.84924 0.292
NP_441198.1_8 Forward -308 -298 12.6854 0.12
NP_441468.1_1 Reverse -148 -155 6.13563 0.209
NP_441468.1_1 Forward -155 -148 6.0373 0.223
NP_441020.2_6 Reverse -145 -162 9.38028 0.173
NP_441020.2_6 Reverse -233 -250 8.7903 0.188
NP_441673.1_1 Reverse -147 -156 1.37636 0.114
NP_441673.1_1 Forward -156 -147 1.1797 0.163
NP_441016.2_6 Reverse -132 -151 4.71854 0.297
NP_441826.1_2 Forward -251 -237 -1.96703 0.261
NP_442868.1_6 Forward -158 -148 6.66654 0.103
NP_442868.1_6 Reverse -145 -155 0.176696 0.247
NP_441056.1_1 Forward -156 -137 -6.39206 0.27
NP_441612.1_2 Reverse -105 -115 10.8728 0.21
NP_442361.1_3 Reverse -141 -154 7.98409 0.285
NP_442427.1_3 Forward -250 -232 2.37909 0.185
NP_442808.1_1 Forward -157 -147 9.71433 0.0481
NP_442542.1_2 Forward -158 -145 15.9489 0.0762
NP_442542.1_9 Reverse -53 -67 6.0955 0.252
NP_442050.1_5 Forward -158 -148 11.7793 0.0832
NP_442050.1_5 Forward -308 -298 7.0594 0.27
NP_442050.1_5 Reverse -145 -155 6.76441 0.282
NP_440558.1_2 Forward -254 -235 -1.08219 0.208
NP_440558.1_2 Reverse -123 -142 -2.55715 0.229
NP_440111.2_2 Reverse -136 -155 -2.45882 0.251
NP_441518.1_3 Reverse -137 -156 4.42435 0.05
NP_441518.1_9 Forward -149 -131 15.8504 0.259
NP_441878.1_6 Reverse -154 -164 0.766681 0.134
NP_441878.1_6 Forward -157 -147 0.57002 0.14
NP_441878.1_6 Reverse -201 -211 -7.68978 0.255
NP_441878.1_6 Forward -171 -161 -7.68978 0.255
NP_441878.1_6 Reverse -235 -245 -7.98478 0.285
NP_441036.1_3 Reverse -297 -316 -3.44213 0.255
NP_441557.1_5 Reverse -147 -156 1.08137 0.0794
NP_441557.1_5 Forward -156 -147 0.589713 0.134
NP_441445.1_1 Reverse -138 -157 3.83436 0.205
NP_441739.1_2 Forward -296 -280 2.41781 0.288
NP_441308.1_8 Forward -247 -237 9.02648 0.236
NP_442183.1_1 Reverse -147 -161 4.91614 0.239
NP_442183.1_1 Reverse -82 -96 4.03116 0.282
NP_441574.1_1 Forward -81 -62 -7.96535 0.3
NP_440058.1_5 Reverse -248 -267 12.8808 0.149
NP_441549.1_9 Reverse -122 -140 -7.06068 0.206
NP_442347.1_2 Forward -155 -146 10.3245 0.058
NP_442347.1_2 Reverse -261 -270 4.32629 0.284
NP_440547.1_1 Reverse -109 -128 10.7167 0.219
NP_442888.1_9 Reverse -60 -79 16.8141 0.171
NP_441633.1_3 Reverse -145 -158 -6.2739 0.242
NP_440136.1_2 Reverse -148 -155 6.23397 0.171
NP_440136.1_2 Forward -155 -148 6.13563 0.193
NP_440136.1_2 Reverse -298 -305 4.26735 0.218
NP_442590.1_9 Forward -157 -138 16.1257 0.206
NP_442998.1_10 Forward -154 -147 15.5754 0.0102
NP_441799.1_1 Forward -160 -146 4.32555 0.255
NP_440640.1_6 Reverse -189 -208 0.884433 0.266
NP_440256.1_1 Reverse -144 -163 -7.86702 0.247
NP_441559.1_8 Reverse -125 -139 -5.01529 0.245
NP_440915.1_6 Reverse -143 -157 1.17956 0.145
NP_440915.1_6 Forward -118 -104 -0.492064 0.197
NP_440717.1_3 Forward -15 -1 7.66879 0.28
NP_441939.1_3 Reverse -148 -167 11.4058 0.112
NP_442993.1_1 Reverse -123 -139 -13.9045 0.295
NP_442386.1_9 Forward -92 -83 7.66912 0.219
NP_442386.1_9 Reverse -296 -305 5.70251 0.241
NP_442386.1_9 Forward -157 -148 4.52254 0.297
NP_440570.1_5 Forward -124 -105 -1.67217 0.276
NP_441340.1_5 Reverse -148 -155 13.5105 0.0314
NP_441340.1_5 Forward -155 -148 5.84064 0.208
NP_442186.1_2 Reverse -245 -264 11.8975 0.197
NP_441947.1_4 Reverse -249 -268 15.8307 0.146
NP_440327.1_6 Forward -153 -134 6.98095 0.228
NP_440586.1_1 Forward -76 -57 0.687771 0.237
NP_440586.1_1 Forward -79 -60 -4.91709 0.278
NP_440586.1_8 Forward -155 -148 9.47853 0.146
NP_440586.1_8 Reverse -156 -163 9.08521 0.178
NP_440586.1_8 Reverse -148 -155 5.74197 0.283
NP_440586.1_9 Forward -76 -57 6.09597 0.288
NP_442959.1_7 Reverse -139 -158 -5.01543 0.295
NP_441262.1_3 Reverse -147 -154 14.7888 0.0223
NP_443051.1_1 Reverse -146 -155 7.47288 0.0571
NP_443051.1_1 Forward -157 -148 -1.18024 0.297
NP_439937.1_9 Reverse -128 -145 -1.43681 0.124
NP_439937.1_9 Reverse -127 -144 -11.1715 0.245
NP_440439.1_1 Reverse -233 -246 -0.275709 0.211
NP_440372.1_2 Reverse -148 -155 13.8055 0.0214
NP_440372.1_2 Forward -155 -148 6.52896 0.188
NP_440267.1_2 Forward -250 -236 13.8636 0.123
NP_442384.1_10 Reverse -236 -249 1.39592 0.26
NP_442572.1_10 Forward -165 -146 15.8856 0.271
NP_441018.1_7 Forward -145 -126 8.84924 0.239
NP_442262.1_10 Forward -155 -148 13.2155 0.0213
NP_442262.1_10 Reverse -156 -163 9.18389 0.211
NP_441689.1_5 Reverse -145 -155 12.7626 0.113
NP_440163.1_10 Forward -78 -68 15.418 0.0762
NP_440163.1_10 Reverse -144 -154 11.3864 0.169
NP_440344.1_10 Forward -163 -146 -10.7776 0.19
NP_440297.1_4 Forward -370 -351 19.6656 0.0538
NP_440297.1_9 Forward -163 -153 -0.216628 0.282
NP_440297.1_9 Forward -155 -145 -0.511621 0.289
NP_440350.1_1 Reverse -182 -201 -4.03212 0.24
NP_442187.1_3 Reverse -146 -156 15.6147 0.105
NP_441592.1_4 Reverse -155 -174 7.57094 0.124
NP_441592.1_4 Reverse -126 -145 -2.26216 0.261
NP_441592.1_4 Reverse -125 -144 -2.26216 0.261
NP_441103.1_9 Forward -243 -233 13.8568 0.234
NP_440999.1_9 Reverse -128 -142 2.65453 0.146
NP_440888.1_2 Forward -156 -142 11.5037 0.0657
NP_440888.1_2 Forward -245 -231 11.4053 0.0681
NP_440491.1_1 Reverse -344 -363 7.69667 0.261
NP_440052.1_5 Forward -243 -224 -3.93378 0.247
NP_442277.1_4 Reverse -120 -139 3.53858 0.223
NP_442033.1_10 Reverse -70 -89 -11.9969 0.261
NP_441543.1_2 Forward -155 -146 7.07956 0.131
NP_441543.1_2 Forward -305 -296 4.22796 0.267
NP_442845.1_2 Reverse -230 -244 4.52282 0.258
NP_442845.1_2 Reverse -141 -155 3.63784 0.282
NP_441548.1_1 Reverse -171 -190 17.5024 0.0684
NP_442578.1_7 Reverse -148 -155 6.0373 0.18
NP_441462.1_2 Reverse -147 -157 16.1063 0.00406
NP_443062.1_1 Forward -156 -138 8.83844 0.145
NP_441560.1_8 Reverse -254 -273 11.7075 0.287
NP_441351.1_8 Reverse -153 -172 2.65439 0.243
NP_440516.1_8 Reverse -147 -156 18.9776 0.00442
NP_440516.1_8 Forward -156 -147 5.01461 0.118
NP_442428.1_5 Reverse -148 -155 6.13563 0.209
NP_442428.1_5 Forward -155 -148 6.0373 0.212
NP_441032.1_4 Forward -245 -226 10.815 0.263
NP_440603.1_3 Reverse -317 -336 6.39097 0.265
NP_440673.1_2 Forward -79 -60 11.8529 0.162
NP_440673.1_3 Forward -154 -147 12.4288 0.0426
NP_441052.1_2 Forward -156 -146 10.6981 0.0285
NP_441052.1_2 Reverse -132 -142 3.81494 0.173
NP_441052.1_2 Forward -245 -235 3.22496 0.182
NP_441052.1_2 Reverse -155 -165 0.668351 0.256
NP_442219.1_9 Forward -155 -146 7.96454 0.0696
NP_440436.1_4 Forward -155 -146 7.57079 0.124
NP_440436.1_4 Forward -305 -296 4.32588 0.272
NP_441884.1_9 Reverse -57 -76 -21.83 0.266
NP_441884.1_9 Forward -159 -140 -25.1733 0.29
NP_440689.1_7 Reverse -165 -183 18.2096 0.169
NP_441719.1_4 Reverse -148 -155 6.82395 0.0855
NP_441719.1_4 Forward -155 -148 6.52896 0.188
NP_441733.1_10 Reverse -144 -157 8.86907 0.132
NP_441733.1_10 Forward -309 -296 5.23083 0.223
NP_441851.1_10 Reverse -81 -91 9.41981 0.114
NP_442814.1_5 Forward -364 -345 17.0099 0.196
NP_442622.1_8 Forward -156 -138 -9.42063 0.145
NP_442856.1_7 Forward -173 -154 -5.99873 0.291
NP_442515.1_1 Reverse -146 -160 5.21113 0.107
NP_442515.1_1 Forward -269 -255 -0.590395 0.228
NP_442515.1_1 Reverse -129 -143 -2.65535 0.277
NP_440165.1_5 Reverse -52 -71 -8.35868 0.298
NP_440432.1_9 Forward -155 -140 0.0782283 0.16
NP_440432.1_9 Reverse -148 -163 -0.708419 0.167
NP_442243.1_3 Forward -252 -233 12.4867 0.279
NP_441570.1_1 Forward -156 -138 8.37728 0.0138
NP_441570.1_1 Reverse -236 -254 -17.5821 0.283
NP_441078.1_4 Reverse -147 -156 0.196389 0.205
NP_441078.1_4 Forward -156 -147 -0.000272808 0.205
NP_441078.1_4 Reverse -236 -245 -1.86856 0.272
NP_441078.1_4 Forward -245 -236 -2.06522 0.295
NP_442729.1_8 Forward -95 -82 9.95071 0.125
NP_440539.1_9 Reverse -139 -158 0.884433 0.278
NP_442443.1_1 Reverse -174 -193 -3.63879 0.267
NP_440526.1_3 Forward -210 -199 1.13984 0.267
NP_440526.1_3 Forward -155 -144 0.54986 0.275
NP_441432.1_8 Reverse -146 -155 14.0611 0.0258
NP_442320.1_8 Reverse -141 -155 1.86788 0.0817
NP_440497.1_2 Forward -155 -136 3.24438 0.3
NP_442003.1_4 Forward -90 -71 12.7825 0.257
NP_442815.1_2 Forward -279 -261 5.62401 0.227
NP_442815.1_2 Forward -140 -122 3.65739 0.259
NP_440199.1_10 Reverse -144 -154 16.7946 0.0381
NP_442489.1_7 Forward -156 -147 0.688044 0.152
NP_442489.1_7 Reverse -147 -156 0.688044 0.152
NP_442489.1_7 Reverse -236 -245 -1.57357 0.213
NP_440941.1_9 Forward -171 -157 17.7975 0.293
NP_440559.1_1 Forward -155 -146 7.76787 0.0918
NP_440559.1_1 Reverse -148 -157 6.39124 0.134
NP_441659.2_8 Forward -156 -146 5.48657 0.106
NP_441659.2_8 Reverse -147 -157 0.275027 0.27
NP_441040.1_2 Forward -143 -124 -16.3235 0.295
NP_442008.1_2 Reverse -123 -142 2.94938 0.27
NP_440779.1_5 Reverse -147 -164 -4.77938 0.116
NP_442346.1_5 Reverse -154 -164 5.5849 0.238
NP_442346.1_5 Forward -157 -147 4.3066 0.291
NP_440545.1_3 Forward -139 -122 2.59545 0.0976
NP_440545.1_3 Forward -140 -123 -6.64766 0.285
NP_441856.1_3 Reverse -127 -146 -2.95047 0.272
NP_441629.1_1 Forward -178 -159 11.7992 0.154
NP_441629.1_3 Reverse -59 -78 -2.06626 0.269
NP_442603.1_7 Reverse -147 -161 10.717 0.125
NP_441050.1_5 Reverse -198 -216 4.44404 0.194
NP_440449.1_6 Forward -164 -146 5.62973 0.273
NP_441948.1_4 Reverse -75 -93 -0.472507 0.139
NP_441833.1_4 Forward -155 -148 6.52896 0.0924
NP_441833.1_4 Reverse -148 -155 6.23397 0.163
NP_442162.1_9 Forward -155 -148 12.9205 0.0282
NP_442162.1_9 Reverse -148 -155 12.9205 0.0282
NP_440671.1_4 Reverse -141 -155 7.07942 0.227
NP_442943.1_1 Reverse -183 -198 3.96695 0.245
NP_442140.1_3 Reverse -148 -158 7.35486 0.142
NP_442723.1_1 Forward -218 -199 3.34192 0.278
NP_441813.1_5 Reverse -145 -155 6.17489 0.1
NP_441813.1_5 Forward -158 -148 5.78156 0.109
NP_440594.1_6 Reverse -126 -145 4.81688 0.289
NP_442089.1_1 Reverse -144 -163 10.2259 0.102
NP_440567.1_1 Reverse -148 -162 0.392915 0.246
NP_442497.1_10 Reverse -148 -157 1.08137 0.115
NP_442497.1_10 Forward -155 -146 0.589713 0.153
NP_440821.1_4 Reverse -145 -155 8.53483 0.0468
NP_440821.1_4 Forward -158 -148 7.35486 0.072
NP_441239.1_9 Forward -158 -146 12.9203 0.0402
NP_441892.1_1 Reverse -138 -155 -1.14113 0.198
NP_442082.1_2 Reverse -135 -154 12.6833 0.122
NP_442044.1_1 Reverse -124 -143 2.85105 0.142
NP_440354.1_7 Reverse -244 -262 8.67227 0.232
NP_442138.1_5 Reverse -97 -116 12.5858 0.276
NP_442138.1_10 Forward -156 -137 -0.197208 0.147
NP_440546.1_4 Reverse -147 -157 14.9908 0.0459
NP_440546.1_4 Reverse -297 -307 9.17338 0.151
NP_440462.1_6 Forward -158 -148 6.46988 0.115
NP_440462.1_9 Forward -248 -229 14.7491 0.156
NP_440868.1_2 Forward -73 -59 17.1984 0.275
NP_440868.1_4 Reverse -143 -155 3.38223 0.136
NP_442479.1_9 Forward -329 -310 -13.8652 0.293
NP_441848.1_7 Forward -50 -31 -3.83621 0.285
NP_442039.1_4 Reverse -148 -155 11.6422 0.0747
NP_442039.1_7 Forward -185 -175 8.1415 0.264
NP_441811.1_8 Reverse -254 -268 7.57108 0.241
NP_442837.1_3 Forward -155 -148 6.0373 0.25
NP_442837.1_3 Reverse -148 -155 6.0373 0.25
NP_440160.1_2 Reverse -166 -185 -2.45882 0.245
NP_442053.1_1 Forward -156 -147 14.4544 0.0114
NP_442053.1_1 Reverse -147 -156 7.86621 0.0863
NP_440505.1_3 Reverse -145 -155 14.7297 0.0176
NP_440505.1_3 Forward -93 -83 8.33817 0.145
NP_440505.1_4 Reverse -304 -323 17.4369 0.261
NP_440914.1_1 Forward -156 -146 13.1043 0.0386
NP_440914.1_1 Reverse -236 -246 9.10306 0.186
NP_440914.1_1 Forward -91 -81 8.6151 0.186
NP_441011.1_8 Forward -305 -296 11.8978 0.0614
NP_441011.1_8 Reverse -148 -157 9.24284 0.131
NP_442533.1_6 Forward -245 -236 6.98123 0.0992
NP_442533.1_6 Forward -156 -147 4.42462 0.179
NP_442533.1_6 Reverse -236 -245 3.93297 0.197
NP_442533.1_6 Reverse -126 -135 2.35967 0.259
NP_442533.1_6 Forward -133 -124 1.67135 0.293
NP_442541.1_10 Forward -164 -150 1.17898 0.29
NP_440263.1_1 Reverse -178 -191 16.435 0.239
NP_439944.1_9 Forward -155 -145 9.22315 0.1
NP_442202.1_1 Forward -127 -111 20.2915 0.0327
NP_442202.1_2 Forward -324 -305 17.5998 0.244
NP_442202.1_4 Reverse -127 -141 14.4836 0.218
NP_442202.1_4 Forward -74 -60 13.3201 0.259
NP_440115.1_6 Forward -309 -299 6.96153 0.166
NP_441602.1_3 Forward -74 -55 -3.14714 0.241
NP_440646.1_4 Reverse -120 -139 17.404 0.0549
NP_441286.1_1 Reverse -146 -158 13.8053 0.00558
NP_440670.1_8 Reverse -147 -156 8.75118 0.0606
NP_440670.1_8 Forward -156 -147 6.19458 0.124
NP_441886.1_2 Forward -189 -170 8.06259 0.227
NP_440886.1_7 Forward -157 -147 6.76441 0.114
NP_442614.1_2 Reverse -201 -215 13.3726 0.128
NP_442213.1_5 Reverse -119 -138 -1.86883 0.293
NP_441403.1_4 Forward -184 -166 6.41066 0.288
NP_442963.1_7 Forward -71 -52 12.6841 0.204
NP_441808.1_8 Reverse -254 -273 8.16093 0.269
NP_440907.2_8 Forward -305 -295 7.15773 0.127
NP_440907.2_8 Reverse -298 -308 3.91283 0.289
NP_441021.1_1 Reverse -156 -175 -10.6203 0.242
NP_440841.1_4 Reverse -145 -164 1.17943 0.119
NP_441463.1_3 Reverse -137 -156 -3.3438 0.174
NP_441626.1_2 Reverse -148 -155 12.2322 0.0511
NP_441626.1_2 Forward -155 -148 5.93897 0.231
NP_442211.1_3 Reverse -173 -192 6.88843 0.295
NP_442794.1_1 Reverse -137 -149 3.77555 0.286
NP_442615.1_1 Forward -165 -147 1.49411 0.0841
NP_442615.1_1 Reverse -288 -306 -6.56903 0.252
NP_441962.1_4 Reverse -127 -146 -5.31042 0.167
NP_441962.1_4 Forward -140 -121 -10.1286 0.224
NP_440387.1_1 Reverse -236 -252 -5.74299 0.249
NP_440855.1_1 Forward -87 -68 9.73422 0.12
NP_441488.1_7 Forward -144 -125 2.55606 0.258
NP_441993.1_1 Forward -72 -53 3.11618 0.241
NP_439938.1_2 Reverse -218 -237 20.059 0.0661
NP_441174.1_1 Reverse -116 -131 10.993 0.258
NP_440814.1_4 Reverse -288 -307 -11.8986 0.228
NP_440114.1_10 Reverse -147 -161 11.0127 0.127
NP_441425.1_3 Reverse -99 -109 15.2213 0.273
NP_441510.2_7 Reverse -141 -155 15.1419 0.28
NP_440766.1_4 Reverse -143 -157 9.63603 0.0871
NP_441237.1_9 Reverse -148 -158 14.1397 0.0488
NP_441133.1_1 Forward -147 -128 14.8474 0.2
NP_439910.1_2 Reverse -289 -306 -14.3175 0.183
NP_442867.1_2 Reverse -118 -137 5.50599 0.202
NP_442867.1_8 Forward -155 -136 7.86593 0.242
NP_440457.1_1 Reverse -197 -209 2.30059 0.214
NP_440457.1_1 Reverse -143 -155 2.30059 0.214
NP_440798.1_6 Reverse -148 -161 2.08423 0.186
NP_441984.1_6 Reverse -149 -161 18.6235 0.119
NP_442509.1_9 Reverse -147 -157 13.1559 0.061
NP_442509.1_9 Forward -368 -358 8.53436 0.192
NP_441496.1_3 Forward -145 -126 14.0599 0.289
NP_440554.1_4 Forward -155 -145 4.10993 0.201
NP_442862.1_3 Forward -328 -311 19.705 0.0702
NP_442862.1_3 Reverse -183 -200 7.11867 0.258
NP_442737.1_5 Forward -151 -132 12.1033 0.265
NP_441885.1_5 Forward -156 -146 1.25834 0.11
NP_441885.1_5 Reverse -147 -157 -0.0199663 0.186
NP_440478.1_9 Forward -132 -113 7.7676 0.28
NP_442341.1_7 Reverse -65 -79 1.47456 0.288
NP_442341.1_7 Reverse -59 -73 1.37622 0.292
NP_440423.1_6 Reverse -139 -158 -3.04881 0.126
NP_443000.1_7 Reverse -145 -155 7.35486 0.0859
NP_441842.1_10 Reverse -140 -154 10.3243 0.165
NP_440275.1_3 Reverse -145 -155 5.5849 0.14
NP_440275.1_3 Forward -158 -148 1.25834 0.291
NP_440091.1_1 Reverse -143 -155 6.72548 0.0921
NP_440679.1_10 Forward -154 -135 -16.3235 0.258
NP_442451.1_2 Reverse -122 -141 -11.4069 0.294
NP_442638.1_3 Reverse -7 -26 11.3154 0.298
NP_439962.1_4 Reverse -67 -86 -5.40875 0.28
NP_442495.1_5 Reverse -121 -140 5.11266 0.293
NP_440149.1_8 Forward -156 -137 -4.13045 0.202
NP_441105.1_3 Forward -175 -156 -3.14714 0.173
NP_440216.1_1 Reverse -147 -161 -4.32697 0.107
NP_440216.1_9 Reverse -157 -166 14.4544 0.175
NP_440216.1_9 Reverse -156 -165 6.78456 0.289
NP_440172.1_1 Reverse -147 -157 7.55152 0.0761
NP_440172.1_1 Reverse -236 -246 2.24165 0.279
NP_440172.1_1 Forward -156 -146 2.24165 0.279
NP_441226.1_7 Reverse -148 -155 12.7234 0.0312
NP_441226.1_7 Forward -155 -148 11.5435 0.0757
NP_441111.1_7 Forward -155 -147 8.86921 0.0589
NP_441766.1_2 Forward -156 -147 14.7494 0.00772
NP_442417.1_5 Reverse -66 -80 6.78443 0.207
NP_440072.1_5 Reverse -193 -211 0.0191479 0.236
NP_440072.1_5 Forward -147 -129 -0.374176 0.238
NP_442116.1_2 Forward -330 -311 16.3215 0.234
NP_442116.1_6 Forward -340 -323 6.64108 0.273
NP_440885.1_6 Reverse -319 -338 5.47397 0.29
NP_442403.1_8 Forward -154 -135 12.4875 0.131
NP_440591.1_9 Forward -171 -153 8.18062 0.187
NP_442154.1_1 Forward -149 -131 -0.570838 0.116
NP_442154.1_1 Forward -108 -90 -17.7788 0.267
NP_442564.1_9 Forward -250 -236 14.0253 0.256
NP_440261.1_5 Forward -134 -121 -4.7006 0.165
NP_440261.1_5 Reverse -148 -161 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGGATTGATACTAGTCAATTTTTGAACTTGGATAATCCCAGTGTGGATATCTACGACCAAATGCTTGACCAAGATTGTCCTGAATTTGACGGAGCTATCCCTGATAATTTATCTAAACTGCGGTTCTACTGGCATCAACTACAACGGAAGCAAGGTCATCCCCTTCTGCTGTTGTTCGAACAGTTGAGTCCCTCCCCCCTAGACCTGGAACAACTTTGGCAGCAGTTGGGCACTTTCCATGGCCCGATCGCCATTTTGGGGGTGACGCCGGCCCCGAAAACTGTGGTGTTGCCCTATTTTCAGTTGCGGGAATCCCAAACTACGGCGGCGGACATTGTCGCTTGGTTGCAAAATTGTCTCACCTCCCCTTGAATTACTAAAATCATCACACTTTGGCT

CDS

ATGACCTATTGTTTGGGTTTAATTAATCGTTTTGGCATGGTCATGGGGGCAGATTCCCGCACTAATGCGGGGGTAGATTATACTTCCGCCTATAAGAAATTATTTGATTATTCTCTCCCTGGCGATCGAATTTTAATTCTTTGCACCTCCGGCAACCTAGCCATTACCCAGGCGGTGCTCCATCAGATTGACCGAGATATCCAGCGGGATGACGGGGACCATCTCCACAACATTGCCACTATGCACGAAGTGGCCACTTACATCGGCGGTAAGGTGCGGGAAATGCAGGAAAAAGACCGACCATGGCTAGAAAAAGATGGCATTGATTTTCAGTGCAATTTCCTCTTGGGAGGGCAAATTAAGGGGGAACCGCACCAGGAATTGTACTTGATTTATCCCCAGGGTAATTTCATCCAAGCCACCAAGGAGACTCCCTTCCTACAAATTGGCGAAACTAAGTATGGCAAGCCGTTGCTGGACCGCACCATCACCTATGACACCCCCCTGGAAGCCATGGCCAAATGCGCCTTGCTTTCCATTGACTCCACTATGAAGTCAAATATTTCCGTTGGGCCCCCCATTAATCTGACCATGGTGGAGGCCAATCATTTTTCCGTGCGCCATACACTACAACTACGCTTGGGAGATCCCTACCTGGCTAAAATGCGTAGCCTGTGGGAATCCTATGTACGTCAAGCTTTCGAGTCCATGCCCAATGTGGAATGGGAAGCCAGCCAAAGCGATTCCGGGGAAGATGTCTTGATTGATTGA

Protein

MTYCLGLINRFGMVMGADSRTNAGVDYTSAYKKLFDYSLPGDRILILCTSGNLAITQAVLHQIDRDIQRDDGDHLHNIATMHEVATYIGGKVREMQEKDRPWLEKDGIDFQCNFLLGGQIKGEPHQELYLIYPQGNFIQATKETPFLQIGETKYGKPLLDRTITYDTPLEAMAKCALLSIDSTMKSNISVGPPINLTMVEANHFSVRHTLQLRLGDPYLAKMRSLWESYVRQAFESMPNVEWEASQSDSGEDVLID