Your browser is old and dusty. Try Google Chrome!

Details for sll0063

ORF sll0063
Accession NP_442213.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -368 -382 9.14437 0.0795
NP_441061.1_2 Forward -265 -251 1.57289 0.186
NP_441061.1_2 Forward -370 -356 -2.06536 0.281
NP_441418.1_6 Forward -382 -363 -30.3848 0.274
NP_440897.1_6 Reverse -291 -310 -2.26292 0.206
NP_442151.1_6 Reverse -5 -19 8.84938 0.164
NP_442151.1_6 Reverse -114 -128 7.17775 0.206
NP_442151.1_6 Reverse -373 -387 5.30946 0.284
NP_440561.1_4 Reverse -289 -308 16.5175 0.158
NP_441818.1_1 Reverse -231 -242 8.80962 0.277
NP_440996.1_3 Forward -383 -365 12.1139 0.221
NP_442752.1_4 Reverse -254 -261 7.90559 0.144
NP_442861.1_1 Reverse -129 -148 11.1109 0.295
NP_440304.1_4 Forward -384 -374 4.60159 0.258
NP_440304.1_4 Forward -302 -292 4.20827 0.272
NP_441781.1_7 Forward -135 -116 7.17762 0.18
NP_441781.1_7 Reverse -361 -380 2.0644 0.21
NP_442181.1_1 Reverse -290 -309 8.55425 0.299
NP_441200.1_4 Forward -337 -318 13.3725 0.156
NP_442110.1_7 Forward -382 -368 6.98109 0.128
NP_442110.1_7 Forward -376 -362 2.35953 0.222
NP_441083.1_5 Forward -14 -4 6.66654 0.0811
NP_441713.1_1 Forward -180 -161 -14.9469 0.26
NP_441713.1_1 Forward -141 -122 -16.4218 0.283
NP_442570.1_3 Forward -378 -359 -2.55715 0.212
NP_442445.1_2 Reverse -375 -394 10.2259 0.288
NP_441598.1_3 Reverse -155 -174 15.0073 0.161
NP_441130.1_10 Forward -296 -282 10.3243 0.114
NP_441486.1_1 Reverse -2 -16 -3.147 0.176
NP_442850.1_6 Reverse -362 -381 17.0107 0.256
NP_440842.1_10 Forward -309 -295 3.53951 0.255
NP_440842.1_10 Reverse -296 -310 3.53951 0.255
NP_440842.1_10 Reverse -358 -372 1.57289 0.288
NP_441014.1_8 Forward -21 -2 3.93269 0.214
NP_441014.1_10 Forward -240 -221 2.26028 0.216
NP_442848.1_5 Forward -308 -290 2.18243 0.276
NP_441012.1_4 Reverse -369 -382 13.7856 0.209
NP_443018.1_3 Forward -375 -368 4.26735 0.267
NP_443018.1_3 Reverse -368 -375 4.16902 0.278
NP_440376.1_1 Reverse -292 -301 1.96635 0.236
NP_442730.1_8 Forward -126 -107 7.86512 0.189
NP_442687.1_7 Forward -15 -5 4.50326 0.245
NP_442687.1_7 Reverse -360 -370 3.71661 0.292
NP_442485.1_3 Forward -387 -368 3.83436 0.193
NP_442530.1_2 Forward -118 -108 14.533 0.203
NP_440642.1_10 Forward -390 -376 3.73557 0.265
NP_440642.1_10 Forward -171 -157 2.06395 0.284
NP_441013.1_2 Forward -387 -369 -4.70074 0.299
NP_441013.1_3 Forward -382 -363 11.3075 0.204
NP_442782.1_2 Forward -117 -103 8.35772 0.198
NP_442782.1_2 Forward -382 -368 0.589577 0.288
NP_442782.1_2 Reverse -103 -117 0.589577 0.288
NP_441414.1_9 Forward -123 -104 -3.93378 0.143
NP_442300.1_4 Forward -38 -19 15.6332 0.213
NP_442937.1_5 Forward -375 -356 7.07928 0.263
NP_442321.1_4 Forward -215 -196 -6.98204 0.284
NP_441127.1_1 Reverse -263 -277 10.6193 0.244
NP_441127.1_1 Reverse -359 -373 8.25939 0.3
NP_440318.1_1 Forward -394 -375 2.3594 0.271
NP_440203.1_5 Reverse -364 -374 9.22267 0.268
NP_441580.1_6 Reverse -155 -174 -7.17871 0.236
NP_440153.1_8 Forward -266 -253 -3.32397 0.295
NP_442571.1_10 Forward -312 -293 19.469 0.289
NP_443055.1_6 Forward -76 -58 -0.964891 0.271
NP_440934.1_1 Forward -361 -342 10.0292 0.202
NP_440827.1_3 Forward -387 -368 15.7324 0.167
NP_442002.1_9 Reverse -304 -311 11.3472 0.185
NP_441646.1_7 Reverse -289 -303 13.7659 0.27
NP_442438.1_10 Reverse -11 -25 0.294584 0.232
NP_441041.1_4 Forward -382 -363 -8.55534 0.204
NP_441041.1_4 Reverse -367 -386 -9.24366 0.214
NP_441041.1_4 Forward -376 -357 -11.8003 0.252
NP_441041.1_4 Forward -388 -369 -12.9802 0.278
NP_442004.1_6 Forward -135 -121 6.98109 0.169
NP_441725.1_5 Reverse -292 -302 0.275027 0.192
NP_440202.1_8 Reverse -157 -176 9.61179 0.297
NP_440983.1_5 Forward -129 -110 -8.94866 0.298
NP_440437.1_1 Forward -360 -341 -2.65548 0.22
NP_440437.1_5 Forward -305 -286 14.5516 0.246
NP_442012.1_1 Forward -20 -1 -1.57384 0.292
NP_440498.1_1 Reverse -117 -135 -3.6191 0.267
NP_442982.1_5 Forward -311 -292 0.786102 0.233
NP_443030.1_4 Reverse -298 -317 -7.37537 0.294
NP_442215.1_2 Reverse -112 -128 -2.10475 0.192
NP_442215.1_2 Reverse -3 -19 -4.1697 0.228
NP_442215.1_5 Reverse -156 -175 20.8456 0.0465
NP_442177.1_5 Forward -373 -359 9.34103 0.24
NP_440929.1_8 Reverse -367 -376 2.94966 0.246
NP_442926.1_3 Forward -387 -368 4.52268 0.254
NP_442554.1_8 Forward -13 -3 3.12662 0.239
NP_442554.1_8 Forward -375 -365 3.02829 0.245
NP_442167.1_6 Forward -201 -185 12.1525 0.229
NP_442142.1_4 Reverse -347 -360 3.16532 0.265
NP_442292.1_1 Forward -13 -4 6.8829 0.0885
NP_442476.1_5 Reverse -120 -139 13.0775 0.256
NP_442476.1_6 Reverse -166 -180 0.0979218 0.274
NP_442381.1_8 Reverse -20 -39 -5.01543 0.14
NP_443009.1_5 Forward -302 -291 4.97473 0.222
NP_442301.1_2 Forward -273 -254 9.63507 0.2
NP_441468.1_1 Forward -375 -368 4.36568 0.237
NP_441020.2_6 Reverse -289 -306 10.2653 0.149
NP_441426.1_6 Reverse -65 -84 18.1907 0.0727
NP_441826.1_2 Reverse -285 -299 -2.45868 0.271
NP_441637.1_9 Forward -184 -166 4.24738 0.245
NP_442490.1_9 Reverse -293 -312 -3.14714 0.227
NP_442868.1_6 Forward -302 -292 3.61828 0.195
NP_442868.1_6 Forward -16 -6 -0.314959 0.284
NP_441056.1_1 Reverse -367 -386 4.71934 0.117
NP_440031.1_10 Reverse -246 -265 2.3594 0.26
NP_442718.1_2 Reverse -197 -216 2.26107 0.203
NP_442050.1_1 Reverse -153 -172 8.84924 0.25
NP_440558.1_2 Reverse -358 -377 11.9958 0.0808
NP_440558.1_2 Reverse -347 -366 -5.80207 0.264
NP_440558.1_2 Forward -133 -114 -6.78538 0.28
NP_440558.1_2 Forward -374 -355 -7.67036 0.298
NP_442789.1_4 Reverse -362 -381 -6.68705 0.287
NP_441878.1_6 Reverse -196 -206 -7.49312 0.231
NP_442066.2_4 Reverse -373 -392 -6.78538 0.254
NP_442066.2_9 Forward -389 -376 8.47575 0.185
NP_441433.1_8 Reverse -373 -392 0.687771 0.238
NP_441433.1_8 Reverse -374 -393 -3.73712 0.283
NP_441308.1_3 Reverse -249 -268 9.14423 0.261
NP_442192.1_7 Reverse -317 -335 19.6853 0.0722
NP_442183.1_9 Reverse -2 -12 9.41981 0.296
NP_441549.1_9 Forward -139 -121 -8.73231 0.237
NP_442998.1_5 Forward -118 -108 8.53483 0.261
NP_442998.1_10 Reverse -128 -135 3.97235 0.297
NP_440899.1_5 Forward -310 -291 6.29264 0.242
NP_441799.1_1 Forward -18 -4 3.63724 0.289
NP_441559.1_8 Reverse -287 -301 -5.21195 0.254
NP_440915.1_6 Reverse -288 -302 9.2427 0.0445
NP_440997.1_6 Forward -95 -76 8.16093 0.285
NP_442158.1_4 Forward -185 -175 13.0581 0.239
NP_442866.1_1 Forward -387 -368 -6.88371 0.261
NP_441464.1_10 Forward -185 -171 8.84938 0.267
NP_440026.1_4 Reverse -288 -307 8.16093 0.28
NP_440306.1_5 Reverse -164 -183 -1.86883 0.298
NP_441494.1_6 Forward -387 -374 15.9489 0.125
NP_442386.1_9 Forward -124 -115 6.19416 0.23
NP_440570.1_5 Forward -386 -367 -4.03212 0.299
NP_441750.1_4 Forward -380 -361 3.24438 0.233
NP_441340.1_5 Reverse -368 -375 4.07068 0.239
NP_442484.1_2 Forward -134 -115 1.86774 0.226
NP_440251.1_4 Forward -183 -166 16.1651 0.137
NP_440586.1_8 Reverse -368 -375 7.70858 0.227
NP_440192.1_5 Forward -388 -369 4.32602 0.254
NP_441232.1_10 Reverse -115 -134 3.6377 0.22
NP_439937.1_9 Reverse -235 -252 -11.6632 0.261
NP_441657.1_5 Reverse -351 -370 2.16274 0.161
NP_439943.1_4 Reverse -108 -127 5.60432 0.284
NP_440991.1_8 Reverse -299 -318 17.4539 0.268
NP_440819.1_5 Reverse -384 -392 17.424 0.185
NP_441803.1_2 Forward -306 -287 5.01433 0.171
NP_439977.1_5 Reverse -361 -380 -0.197208 0.22
NP_441572.1_3 Forward -386 -367 8.65258 0.261
NP_441572.1_7 Forward -20 -1 -5.21209 0.253
NP_441572.1_7 Reverse -155 -174 -6.39206 0.29
NP_441018.1_7 Forward -374 -355 6.58763 0.285
NP_440297.1_9 Reverse -368 -378 6.76487 0.17
NP_440297.1_9 Forward -375 -365 -0.314959 0.282
NP_442187.1_3 Reverse -4 -14 16.2046 0.0938
NP_440999.1_9 Forward -198 -184 -3.147 0.287
NP_440888.1_2 Forward -175 -161 9.14375 0.137
NP_440888.1_2 Forward -301 -287 6.88214 0.217
NP_442892.1_9 Reverse -66 -80 14.6503 0.293
NP_441469.1_8 Forward -377 -368 6.09625 0.236
NP_442337.1_8 Forward -187 -168 0.884433 0.244
NP_441621.1_7 Reverse -348 -362 -3.34366 0.188
NP_441621.1_7 Forward -384 -370 -6.09693 0.275
NP_443062.1_1 Reverse -367 -385 5.6207 0.224
NP_440936.1_10 Reverse -78 -97 0.524783 0.241
NP_442204.1_1 Reverse -157 -168 7.23683 0.137
NP_440516.1_6 Forward -329 -315 6.98048 0.285
NP_440516.1_8 Reverse -5 -14 -0.295266 0.232
NP_442428.1_5 Forward -375 -368 4.66067 0.244
NP_441052.1_2 Forward -14 -4 1.55333 0.238
NP_442414.1_4 Forward -48 -29 7.66927 0.228
NP_442907.1_9 Reverse -121 -140 -0.4922 0.225
NP_441733.1_10 Reverse -20 -33 6.70579 0.176
NP_441004.1_1 Forward -306 -287 -14.9469 0.271
NP_441004.1_1 Reverse -191 -210 -15.8318 0.279
NP_441004.1_2 Reverse -186 -205 0.687771 0.23
NP_441004.1_2 Forward -256 -237 -4.13045 0.288
NP_441004.1_3 Reverse -31 -50 1.86774 0.282
NP_441004.1_4 Forward -248 -238 9.32148 0.259
NP_441004.1_4 Reverse -194 -204 8.82982 0.263
NP_441004.1_5 Forward -249 -235 8.45605 0.274
NP_442813.1_5 Forward -180 -161 4.52268 0.254
NP_442695.1_3 Reverse -376 -390 16.7152 0.213
NP_441668.1_4 Reverse -187 -206 -0.787193 0.262
NP_442515.1_1 Reverse -196 -210 3.04785 0.125
NP_442515.1_1 Reverse -164 -178 -3.44199 0.29
NP_441982.1_6 Reverse -383 -392 12.4854 0.275
NP_440463.1_4 Forward -257 -238 19.5664 0.0801
NP_440463.1_8 Forward -273 -254 8.46802 0.264
NP_442843.1_1 Forward -122 -103 -11.2103 0.286
NP_441124.1_5 Reverse -102 -112 15.5864 0.188
NP_441124.1_5 Forward -118 -108 12.4352 0.221
NP_442006.1_2 Reverse -26 -43 -14.9075 0.211
NP_440483.1_1 Reverse -53 -72 -0.295539 0.199
NP_441078.1_4 Forward -135 -126 4.71961 0.13
NP_441078.1_4 Reverse -126 -135 -1.37691 0.254
NP_441528.1_2 Forward -133 -114 6.98015 0.297
NP_442443.1_1 Reverse -189 -208 -3.44213 0.267
NP_442443.1_4 Forward -120 -110 16.7941 0.14
NP_441432.1_8 Forward -371 -362 5.40793 0.158
NP_441732.1_2 Forward -18 -2 -17.641 0.281
NP_442343.1_10 Reverse -165 -184 8.75091 0.289
NP_440313.1_5 Forward -124 -106 12.3097 0.235
NP_441737.1_7 Forward -40 -21 12.6841 0.172
NP_440290.1_1 Reverse -102 -111 17.3727 0.21
NP_440760.1_1 Reverse -126 -145 -14.8485 0.137
NP_442797.1_1 Forward -273 -254 -1.57384 0.236
NP_441131.1_9 Forward -37 -18 17.8957 0.164
NP_441057.1_4 Forward -398 -380 -1.25915 0.272
NP_440713.1_4 Reverse -116 -135 6.98095 0.184
NP_440757.1_7 Reverse -368 -386 -0.7675 0.269
NP_441022.1_1 Forward -115 -106 15.9587 0.163
NP_442913.1_10 Reverse -283 -302 -2.85214 0.192
NP_441800.1_7 Forward -280 -262 -3.81576 0.281
NP_442346.1_1 Forward -370 -351 21.0423 0.0856
NP_442346.1_5 Reverse -196 -206 6.66654 0.195
NP_440352.1_5 Reverse -325 -344 10.709 0.27
NP_440545.1_3 Forward -386 -369 1.90713 0.11
NP_440486.1_6 Reverse -354 -373 6.39097 0.283
NP_440010.1_3 Reverse -23 -42 -5.31042 0.25
NP_441943.1_8 Forward -310 -291 -12.4886 0.261
NP_442551.1_4 Forward -208 -193 -3.36336 0.287
NP_441948.1_9 Forward -38 -20 12.2122 0.297
NP_440671.1_4 Forward -382 -368 10.4227 0.158
NP_440671.1_4 Reverse -285 -299 7.9644 0.205
NP_440590.1_4 Reverse -127 -140 -6.07724 0.299
NP_440719.1_9 Reverse -345 -364 16.7149 0.284
NP_440821.1_4 Forward -378 -368 -0.806614 0.296
NP_441239.1_9 Forward -361 -349 4.46387 0.253
NP_440624.1_5 Forward -122 -104 7.95661 0.285
NP_440665.1_2 Forward -309 -290 1.37609 0.188
NP_440796.1_3 Forward -307 -289 14.9646 0.187
NP_440949.1_7 Reverse -198 -217 8.55343 0.28
NP_440354.1_7 Reverse -25 -43 9.75391 0.224
NP_442052.1_3 Forward -377 -358 15.8307 0.128
NP_442052.1_7 Reverse -346 -360 12.9793 0.249
NP_441230.1_5 Forward -387 -368 2.55606 0.212
NP_440462.1_6 Forward -34 -24 1.65166 0.294
NP_441497.1_3 Forward -124 -105 -10.9153 0.294
NP_442402.1_2 Forward -396 -382 16.9119 0.263
NP_442402.1_4 Reverse -118 -137 -7.3761 0.274
NP_442402.1_6 Forward -252 -243 13.1761 0.289
NP_442402.1_10 Forward -129 -119 12.5659 0.206
NP_442402.1_10 Reverse -84 -94 10.1076 0.3
NP_441084.1_6 Reverse -124 -138 9.8289 0.263
NP_442039.1_7 Forward -121 -111 13.943 0.211
NP_442679.1_1 Reverse -303 -322 -5.80207 0.298
NP_440825.1_6 Reverse -64 -83 8.84924 0.285
NP_442837.1_8 Reverse -18 -36 14.2771 0.261
NP_440160.1_2 Forward -301 -282 -4.13045 0.26
NP_442053.1_1 Reverse -5 -14 4.62128 0.235
NP_442360.1_5 Forward -307 -297 13.1564 0.289
NP_442360.1_5 Reverse -298 -308 13.1564 0.289
NP_441959.1_9 Reverse -353 -372 18.4857 0.0957
NP_441203.1_1 Forward -313 -294 -5.50708 0.0988
NP_442532.1_7 Reverse -254 -268 1.86788 0.261
NP_440548.1_3 Reverse -260 -279 14.7491 0.227
NP_440914.1_1 Forward -123 -113 7.73678 0.224
NP_441089.1_5 Forward -384 -365 17.699 0.251
NP_439944.1_9 Forward -375 -365 10.5014 0.0887
NP_441028.1_6 Reverse -85 -95 5.48612 0.255
NP_441028.1_6 Forward -392 -382 5.19112 0.265
NP_440007.1_9 Forward -380 -366 1.86788 0.282
NP_441972.1_5 Reverse -362 -381 5.60432 0.0917
NP_441972.1_5 Reverse -280 -299 -4.32711 0.21
NP_439903.1_6 Forward -385 -366 2.16195 0.231
NP_441286.1_1 Reverse -4 -16 -4.77924 0.175
NP_441286.1_1 Forward -371 -359 -5.86088 0.229
NP_440886.1_7 Forward -198 -188 3.91283 0.26
NP_442614.1_2 Reverse -5 -19 9.14437 0.242
NP_440404.1_9 Forward -91 -72 8.06865 0.263
NP_442213.1_6 Forward -40 -21 20.944 0.0687
NP_441069.1_8 Reverse -70 -89 19.8386 0.189
NP_441808.1_8 Reverse -2 -21 8.65258 0.259
NP_441021.1_1 Forward -387 -368 -11.5053 0.267
NP_441463.1_3 Reverse -116 -135 -4.81876 0.215
NP_441460.1_2 Forward -341 -328 17.0299 0.125
NP_442794.1_1 Forward -127 -115 6.03717 0.198
NP_442467.1_5 Forward -335 -316 17.2327 0.233
NP_441962.1_4 Reverse -374 -393 -0.39387 0.117
NP_441962.1_4 Reverse -258 -277 -12.1936 0.253
NP_441962.1_4 Reverse -192 -211 -13.2752 0.271
NP_440387.1_1 Reverse -14 -30 -6.33298 0.279
NP_441993.1_1 Forward -370 -351 6.13735 0.186
NP_441993.1_1 Forward -376 -357 4.18821 0.223
NP_441993.1_1 Forward -388 -369 3.31109 0.237
NP_440467.1_3 Reverse -28 -47 13.8931 0.183
NP_442323.1_7 Forward -387 -368 0.785326 0.299
NP_440293.1_3 Forward -378 -359 0.196116 0.224
NP_440766.1_5 Forward -120 -108 7.75128 0.288
NP_440766.1_5 Reverse -100 -112 6.79636 0.292
NP_442743.1_1 Forward -133 -114 7.27514 0.266
NP_440213.1_5 Reverse -103 -122 12.3892 0.205
NP_440801.1_8 Forward -295 -276 -0.787193 0.273
NP_441332.1_6 Forward -198 -188 13.583 0.184
NP_441332.1_6 Forward -42 -32 12.6149 0.221
NP_441489.1_3 Forward -120 -106 10.4202 0.232
NP_442936.1_10 Forward -116 -102 12.3264 0.216
NP_442514.1_5 Forward -131 -112 -5.01617 0.254
NP_440554.1_4 Reverse -368 -378 3.51995 0.227
NP_441885.1_5 Reverse -126 -136 0.176696 0.177
NP_442341.1_7 Reverse -229 -243 4.12949 0.2
NP_442341.1_9 Reverse -353 -367 6.39049 0.228
NP_441756.1_5 Reverse -288 -307 2.26107 0.212
NP_443000.1_3 Reverse -254 -273 11.0377 0.256
NP_442932.1_3 Reverse -306 -325 12.9783 0.197
NP_440679.1_10 Reverse -247 -266 -14.2585 0.226
NP_441359.1_5 Forward -263 -244 6.88262 0.186
NP_441122.1_1 Reverse -110 -125 3.71647 0.28
NP_440149.1_8 Reverse -361 -380 -3.24547 0.185
NP_441105.1_3 Forward -393 -374 -5.70374 0.223
NP_440216.1_9 Forward -121 -112 7.17789 0.286
NP_440172.1_1 Reverse -5 -15 5.97822 0.121
NP_442015.1_10 Forward -380 -367 -0.37404 0.264
NP_441226.1_7 Reverse -368 -375 11.2485 0.0971
NP_441111.1_7 Forward -13 -5 -0.570565 0.233
NP_441766.1_2 Reverse -5 -14 2.06468 0.265
NP_442252.1_5 Forward -374 -355 9.0459 0.299
NP_443052.1_9 Forward -264 -245 2.75272 0.168
NP_440845.1_1 Reverse -65 -84 -5.11376 0.239
NP_442154.1_1 Reverse -32 -50 -15.9105 0.228
NP_440261.1_5 Reverse -6 -19 -10.7971 0.21
NP_440261.1_5 Reverse -374 -387 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAGCTGATTTTTCCCGAGGCCACTGCGTTGGCATTTGCGCCGCCCTGGTACCGTCAATTTTACTCTGGACCACCATTTGCGCCGTTTTAATTGCCCTAGGGCAACCCCGCTGGTCAGTTAACACTGCCTACGTTGCCACCCTCACCGTCTGTGGAGTAATGGTGCTCCACGTTGCTTCTTGGTTCAGTATTGGGGTCATTACCCCAGTCACCTTTATTTTGTTGGGGCTTTCCCTCTCCTGTGGGAGCTTAGCTACCCTGTTTTGGCGATACTCTTCCCAATGGCAAAAATTTTGTCACTCCGGATTGAGGGAAACAATCAAAGCTAAATGGCCCCAGACCTTAAAGATTTGACACTCCCACGACCCCTGGATCGAGGCTCTCTGCGAGACCGCCAACT

CDS

ATGACAGAACCAGCCAACAATCATCCCAGTCCCCCGCCGCAAAATTGGTTGTTCAAATGGTGGAATTCCCTCAATGCCATCACCCGCCTATTAGTGTTAGTACTGGGGGCCCCGTTAATGGTGCTCAATGCCAGGGCCCTGTCCTCGATTTTTGGTTATTTTGAATCCCTTTTTGTTATTAGCCTCATTGCCTCCGTCATCGCCTTTTTACTCAACTACCCGGTGGCCTGGCTAGAAAAACAAGGGGCTAAACGTTTTGTGGCGGCTAGTTTTGTTTTCCTCACCGCCCTGATTATTTTCACCGCCCTGGGGGTAACCCTCATTCCCCTCGCCCTATCCCAAGCCCAACAACTGGTGGCCCGCCTACCGGATTGGCTCGATTCGGGGCAGAAACAATTGGTATTGTTGGATCAAAAGGCAGAGATTCTTGGTTGGCCGGTCAATTTTGATGGTCTTATTCCCCAAATTAACAGCCGCCTAGCGGCCGAATTACAAAACTTGGCTGGCAGCACCCTCAACCTCGCCCTAAGCTTGACCGTCTTCACCGTAGTGCGTTTGCTGGACGTACTGTTGACGATAATTTTGACCTTTTATCTCCTCCTCCACACCGACGATGTTTGGCAAAGCATCATAGGTTGGTTGCCAGAGCGTTTCCAAAAACCTTTTTCTGATACTCTACGCCGCAGTTTCCAAAACTATTTCCTCGGCCAATTGGTGTCCGCCACCTGCATGGCCCTGGGGCTGATTTCTGGCTTTTTACTGCTCAAAGTTCCCTTTGGCTTACTTTTTGGCCTCACGGTGGGAGTAATGGCCCTAATTCCTTTTGGTGGGTCGGTGGGCATTGTGCTGGTTACTTTTTTGGTAGCTCTGCGGGACATTGGCATGGCGTTGCAACTGCTGGCGGTGGCTCTAGTGATCCAGCAAATTGTTGAAAATGGCATTGCCCCCAGGGTACTGGGCAGTGTGACAGGATTAAATCCCTTTTGGGTCTTGATTTCCCTGTTAACCGGGGCCAGAATCGGCGGACTACTGGGGGTAATAGTGGCTGTGCCTTCGGCTGTGATGATTAAGGAGGCCCTGGGAGCAATCCGCAGCATGAAGCCCTTGGTGCCAGCCCCAGACCATAATCAAGACCCTTTGTACTTTAAAAACCAGGAAGAAGTGCAACCACTGCCCCCCCGGCCTTAG

Protein

MTEPANNHPSPPPQNWLFKWWNSLNAITRLLVLVLGAPLMVLNARALSSIFGYFESLFVISLIASVIAFLLNYPVAWLEKQGAKRFVAASFVFLTALIIFTALGVTLIPLALSQAQQLVARLPDWLDSGQKQLVLLDQKAEILGWPVNFDGLIPQINSRLAAELQNLAGSTLNLALSLTVFTVVRLLDVLLTIILTFYLLLHTDDVWQSIIGWLPERFQKPFSDTLRRSFQNYFLGQLVSATCMALGLISGFLLLKVPFGLLFGLTVGVMALIPFGGSVGIVLVTFLVALRDIGMALQLLAVALVIQQIVENGIAPRVLGSVTGLNPFWVLISLLTGARIGGLLGVIVAVPSAVMIKEALGAIRSMKPLVPAPDHNQDPLYFKNQEEVQPLPPRP