Your browser is old and dusty. Try Google Chrome!

Details for sll0051

ORF sll0051
Accession NP_442230.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -311 -325 2.16287 0.178
NP_441061.1_2 Reverse -317 -331 -1.5737 0.265
NP_441418.1_6 Reverse -316 -335 -1.7705 0.0154
NP_441418.1_6 Forward -325 -306 -20.7484 0.125
NP_441418.1_6 Reverse -294 -313 -29.4998 0.228
NP_441418.1_6 Reverse -310 -329 -29.8932 0.245
NP_440897.1_6 Reverse -316 -335 -1.37794 0.188
NP_441453.1_4 Forward -325 -317 6.80426 0.121
NP_441453.1_4 Reverse -316 -324 6.11594 0.121
NP_442151.1_6 Forward -325 -311 9.14437 0.157
NP_440150.1_6 Reverse -313 -332 1.57275 0.287
NP_442173.1_1 Reverse -317 -325 12.0158 0.0316
NP_442173.1_1 Forward -324 -316 4.83764 0.241
NP_442752.1_4 Forward -325 -318 13.8055 0.0199
NP_442752.1_4 Reverse -306 -313 7.90559 0.144
NP_440784.1_7 Forward -324 -317 6.23397 0.241
NP_440784.1_7 Reverse -317 -324 6.13563 0.241
NP_442909.1_7 Forward -324 -310 11.9953 0.131
NP_442909.1_7 Reverse -311 -325 8.94708 0.161
NP_440110.1_8 Reverse -320 -339 -0.4922 0.225
NP_439979.1_2 Reverse -322 -341 7.86593 0.26
NP_439979.1_2 Reverse -316 -335 6.29264 0.292
NP_440370.1_10 Reverse -307 -326 12.6841 0.14
NP_442110.1_7 Forward -325 -311 7.47274 0.116
NP_441925.1_4 Forward -316 -297 -10.916 0.243
NP_440856.1_7 Reverse -313 -332 -8.94866 0.28
NP_441083.1_5 Reverse -316 -326 8.82982 0.03
NP_441083.1_5 Forward -325 -315 7.05986 0.067
NP_442827.1_8 Forward -333 -314 9.53674 0.07
NP_441738.1_2 Reverse -318 -325 15.28 0.0102
NP_441558.1_5 Reverse -314 -333 10.2259 0.102
NP_440209.1_1 Forward -325 -317 8.57422 0.0425
NP_440209.1_1 Reverse -316 -324 5.52596 0.0821
NP_441713.1_1 Forward -85 -66 -15.8318 0.273
NP_441716.1_1 Reverse -300 -314 9.63603 0.111
NP_442111.1_4 Reverse -315 -329 14.9459 0.0259
NP_440851.1_3 Forward -381 -362 1.67108 0.285
NP_440906.1_5 Forward -324 -317 6.23397 0.234
NP_440906.1_5 Reverse -317 -324 6.13563 0.241
NP_440747.1_10 Reverse -313 -325 -11.8591 0.161
NP_441130.1_10 Reverse -314 -328 7.57108 0.155
NP_441486.1_1 Forward -328 -314 2.45787 0.0831
NP_441014.1_8 Forward -338 -319 -6.78538 0.276
NP_441014.1_8 Forward -308 -289 -8.06369 0.282
NP_443018.1_3 Reverse -317 -324 11.7405 0.0655
NP_443018.1_3 Forward -324 -317 5.44732 0.193
NP_441316.1_7 Forward -305 -290 -2.18338 0.246
NP_440376.1_1 Forward -325 -316 5.99792 0.111
NP_440376.1_1 Reverse -316 -325 -0.196935 0.285
NP_442687.1_7 Reverse -315 -325 5.97822 0.179
NP_442687.1_7 Forward -326 -316 4.50326 0.245
NP_442191.1_4 Reverse -317 -331 12.1566 0.225
NP_442485.1_3 Forward -314 -295 -5.50708 0.291
NP_442485.1_3 Forward -330 -311 -5.80207 0.296
NP_442766.1_7 Forward -135 -121 20.5508 0.123
NP_442658.1_1 Forward -327 -317 6.17443 0.235
NP_440141.1_4 Reverse -297 -316 -11.9969 0.298
NP_442205.1_9 Forward -360 -344 2.22182 0.221
NP_442205.1_9 Forward -359 -343 -3.48138 0.283
NP_440607.1_8 Reverse -292 -311 1.86774 0.264
NP_439959.1_6 Forward -23 -4 5.99764 0.274
NP_441958.1_5 Reverse -315 -325 0.865012 0.12
NP_441958.1_5 Forward -326 -316 0.865012 0.12
NP_442260.1_4 Reverse -188 -207 24.7789 0.00669
NP_440984.1_7 Reverse -271 -285 5.60446 0.248
NP_441097.1_2 Reverse -324 -341 5.34871 0.259
NP_441580.1_6 Forward -336 -317 -8.752 0.271
NP_440153.1_5 Reverse -317 -331 1.67122 0.245
NP_440200.1_5 Reverse -312 -331 7.66927 0.235
NP_442051.1_8 Reverse -301 -320 23.4022 0.0157
NP_443055.1_6 Forward -346 -328 -2.34152 0.294
NP_442002.1_1 Reverse -327 -345 -3.52077 0.212
NP_442002.1_9 Forward -326 -319 10.7572 0.185
NP_441294.1_7 Forward -313 -299 11.1704 0.153
NP_442438.1_10 Forward -330 -316 0.0979218 0.239
NP_442431.1_10 Reverse -291 -309 3.95239 0.213
NP_441000.1_6 Reverse -315 -329 4.42448 0.0953
NP_442771.1_1 Forward -353 -335 -4.70074 0.166
NP_442771.1_1 Forward -327 -309 -6.4707 0.168
NP_442771.1_1 Forward -319 -301 -8.53565 0.198
NP_440147.1_4 Reverse -68 -81 5.91914 0.109
NP_441550.1_8 Reverse -314 -324 10.796 0.0625
NP_441550.1_8 Forward -327 -317 4.7978 0.283
NP_440206.1_4 Reverse -311 -330 1.57197 0.289
NP_442396.1_5 Reverse -272 -285 10.8357 0.106
NP_441725.1_5 Forward -324 -314 9.32148 0.0553
NP_441725.1_5 Reverse -317 -327 1.455 0.135
NP_439966.1_7 Reverse -314 -324 8.82935 0.13
NP_439966.1_7 Forward -327 -317 8.73102 0.13
NP_439966.1_9 Forward -327 -318 0.983037 0.253
NP_442941.1_3 Reverse -317 -327 1.65166 0.147
NP_442941.1_5 Reverse -128 -142 19.0131 0.0751
NP_440289.1_2 Forward -328 -315 3.75586 0.0741
NP_440289.1_2 Reverse -313 -326 -3.81562 0.271
NP_441514.1_4 Forward -215 -196 12.8913 0.273
NP_442281.1_1 Reverse -311 -325 9.04542 0.0747
NP_442281.1_5 Reverse -319 -338 16.5182 0.201
NP_441079.1_7 Forward -215 -196 -4.81951 0.254
NP_440177.1_1 Reverse -312 -330 2.77242 0.295
NP_442256.1_2 Reverse -314 -332 -4.40575 0.214
NP_440437.1_1 Reverse -310 -329 -3.14714 0.232
NP_441644.1_6 Reverse -316 -326 7.15773 0.133
NP_441644.1_6 Reverse -300 -310 4.99446 0.216
NP_443049.1_6 Forward -326 -316 11.6409 0.24
NP_440253.1_2 Reverse -316 -334 0.117479 0.196
NP_440929.1_8 Reverse -316 -325 7.07956 0.0713
NP_440576.1_2 Reverse -195 -214 18.584 0.0571
NP_442554.1_8 Reverse -317 -327 4.0116 0.2
NP_442554.1_8 Forward -324 -314 2.92996 0.249
NP_442970.1_1 Reverse -7 -21 10.7067 0.269
NP_441762.1_7 Forward -326 -314 -5.46756 0.212
NP_441762.1_7 Reverse -315 -327 -5.86088 0.246
NP_442142.1_4 Reverse -313 -326 11.8184 0.0518
NP_442292.1_1 Reverse -317 -326 -0.196935 0.239
NP_442292.1_2 Reverse -133 -147 17.0037 0.248
NP_441715.1_4 Reverse -317 -327 6.46988 0.143
NP_441468.1_1 Forward -318 -311 6.72562 0.126
NP_441468.1_1 Forward -324 -317 6.13563 0.209
NP_441468.1_1 Reverse -317 -324 6.0373 0.223
NP_441020.2_6 Forward -327 -310 14.8868 0.0469
NP_441015.1_10 Reverse -295 -314 -2.95047 0.184
NP_441015.1_10 Reverse -317 -336 -4.32711 0.202
NP_441015.1_10 Reverse -323 -342 -11.2103 0.292
NP_441673.1_1 Forward -325 -316 1.37636 0.114
NP_441673.1_1 Reverse -316 -325 1.1797 0.163
NP_441876.1_9 Reverse -346 -356 10.206 0.299
NP_441826.1_2 Forward -331 -317 2.2612 0.132
NP_441826.1_2 Reverse -310 -324 1.17956 0.161
NP_441764.1_8 Forward -234 -224 10.7365 0.3
NP_442868.1_6 Forward -311 -301 0.176696 0.247
NP_441056.1_1 Forward -325 -306 -9.44032 0.3
NP_442227.1_2 Forward -344 -325 0.0977854 0.253
NP_442227.1_2 Forward -343 -324 -3.14714 0.289
NP_442361.1_3 Forward -331 -318 10.7374 0.272
NP_442808.1_1 Reverse -315 -325 9.71433 0.0481
NP_442808.1_1 Forward -339 -329 3.51951 0.238
NP_442542.1_2 Forward -327 -314 9.06573 0.142
NP_442542.1_9 Forward -332 -318 21.6317 0.00646
NP_442050.1_5 Reverse -314 -324 12.6642 0.0534
NP_441878.1_6 Reverse -315 -325 0.57002 0.14
NP_441036.1_8 Forward -326 -316 6.8632 0.213
NP_442650.1_2 Forward -325 -311 4.91614 0.16
NP_441557.1_5 Forward -325 -316 1.08137 0.0794
NP_441557.1_5 Reverse -316 -325 0.589713 0.134
NP_441557.1_8 Reverse -351 -361 16.0075 0.18
NP_441590.1_1 Forward -319 -300 9.24257 0.283
NP_441590.1_4 Forward -313 -294 2.9486 0.29
NP_441308.1_8 Forward -327 -317 8.4365 0.254
NP_440101.1_3 Forward -330 -311 2.85105 0.244
NP_441458.1_10 Reverse -307 -326 3.24438 0.252
NP_442183.1_1 Forward -325 -311 11.701 0.0693
NP_442183.1_9 Reverse -297 -307 17.2863 0.206
NP_442397.1_9 Forward -325 -306 5.99764 0.246
NP_441773.1_5 Forward -165 -147 13.883 0.259
NP_442347.1_2 Reverse -317 -326 8.94785 0.0718
NP_442965.1_3 Forward -317 -298 0.0977854 0.218
NP_440136.1_2 Forward -324 -317 6.23397 0.171
NP_440136.1_2 Reverse -317 -324 6.13563 0.193
NP_442590.1_10 Forward -331 -312 9.14423 0.2
NP_442590.1_10 Reverse -316 -335 4.62101 0.273
NP_442998.1_5 Reverse -19 -29 7.84651 0.28
NP_442998.1_10 Reverse -318 -325 15.5754 0.0102
NP_440299.1_4 Forward -321 -302 20.649 0.149
NP_441007.1_10 Reverse -295 -308 6.60746 0.161
NP_441007.1_10 Reverse -289 -302 -0.570702 0.287
NP_442333.2_5 Forward -342 -323 -14.1602 0.272
NP_440256.1_1 Reverse -313 -332 0.0977854 0.087
NP_440915.1_6 Forward -329 -315 4.12949 0.0999
NP_440915.1_6 Reverse -113 -127 -1.96703 0.254
NP_440319.1_5 Forward -317 -298 13.6666 0.294
NP_442866.1_1 Forward -330 -311 3.34271 0.151
NP_440748.1_4 Reverse -294 -313 12.88 0.292
NP_440702.1_2 Reverse -320 -339 -6.49039 0.26
NP_440026.1_4 Reverse -319 -338 10.6192 0.239
NP_442386.1_9 Forward -326 -317 5.9975 0.23
NP_442386.1_9 Forward -304 -295 4.62087 0.294
NP_442386.1_9 Reverse -315 -324 4.52254 0.297
NP_441750.1_1 Reverse -285 -304 -12.6852 0.3
NP_441750.1_1 Reverse -322 -341 -13.2752 0.3
NP_441340.1_5 Forward -324 -317 13.5105 0.0314
NP_441340.1_5 Reverse -317 -324 5.84064 0.208
NP_440327.1_6 Reverse -319 -338 2.16274 0.299
NP_440586.1_8 Reverse -317 -324 9.47853 0.146
NP_440586.1_8 Forward -324 -317 5.74197 0.283
NP_440586.1_8 Forward -302 -295 5.64364 0.297
NP_440684.1_9 Reverse -244 -258 8.94771 0.221
NP_441262.1_3 Forward -325 -318 14.7888 0.0223
NP_443051.1_1 Forward -326 -317 7.47288 0.0571
NP_443051.1_1 Reverse -315 -324 -1.18024 0.297
NP_439937.1_8 Reverse -292 -311 -5.60541 0.299
NP_439937.1_9 Reverse -315 -332 -10.8765 0.236
NP_440439.1_1 Forward -328 -315 9.36073 0.0465
NP_440372.1_2 Forward -324 -317 13.8055 0.0214
NP_440372.1_2 Reverse -317 -324 6.52896 0.188
NP_440316.1_10 Forward -326 -316 11.1898 0.214
NP_441803.1_2 Reverse -311 -330 -0.197208 0.269
NP_440139.1_1 Forward -331 -312 16.3215 0.0474
NP_442384.1_10 Reverse -316 -329 5.23083 0.134
NP_441018.1_7 Forward -329 -310 7.66927 0.268
NP_442262.1_10 Reverse -317 -324 13.2155 0.0213
NP_441689.1_5 Forward -327 -317 5.97777 0.197
NP_441689.1_5 Reverse -364 -374 5.28945 0.273
NP_440344.1_10 Reverse -309 -326 -9.40093 0.146
NP_440189.1_2 Reverse -308 -327 6.68596 0.25
NP_440487.1_1 Reverse -313 -332 -2.26216 0.214
NP_441640.1_8 Reverse -317 -336 0.687771 0.187
NP_441640.1_8 Forward -330 -311 -3.73712 0.259
NP_440297.1_9 Forward -324 -314 0.865012 0.282
NP_440297.1_9 Reverse -317 -327 -0.511621 0.289
NP_442187.1_3 Reverse -299 -309 13.5497 0.245
NP_441896.1_3 Forward -334 -315 -1.47551 0.26
NP_440894.1_10 Forward -320 -301 8.75091 0.17
NP_440894.1_10 Reverse -311 -330 5.60432 0.228
NP_443036.1_9 Forward -340 -321 17.994 0.187
NP_442129.1_9 Reverse -128 -147 17.0481 0.225
NP_440888.1_2 Reverse -316 -330 15.6336 0.00976
NP_441949.1_4 Reverse -295 -314 10.8159 0.192
NP_441543.1_2 Reverse -317 -326 8.65285 0.0968
NP_442845.1_2 Forward -325 -311 13.8643 0.0893
NP_441304.1_10 Reverse -151 -160 12.5861 0.297
NP_441469.1_8 Forward -326 -317 6.39124 0.227
NP_442315.1_1 Reverse -292 -310 16.1454 0.0925
NP_443064.1_6 Forward -315 -305 10.9186 0.13
NP_442578.1_7 Forward -324 -317 6.0373 0.18
NP_441462.1_2 Forward -325 -315 16.1063 0.00406
NP_440936.1_6 Reverse -133 -145 18.5246 0.107
NP_442204.1_1 Forward -329 -318 7.92515 0.108
NP_442204.1_1 Forward -45 -34 2.71361 0.266
NP_442204.1_2 Forward -335 -316 9.24257 0.225
NP_442204.1_5 Reverse -306 -325 3.53937 0.187
NP_440516.1_8 Forward -325 -316 18.9776 0.00442
NP_440516.1_8 Reverse -316 -325 5.01461 0.118
NP_442428.1_4 Forward -326 -307 2.94938 0.247
NP_442428.1_5 Forward -324 -317 6.13563 0.209
NP_442428.1_5 Reverse -317 -324 6.0373 0.212
NP_442428.1_7 Reverse -265 -284 6.19431 0.29
NP_440673.1_2 Reverse -290 -309 7.95079 0.286
NP_440673.1_3 Reverse -318 -325 12.4288 0.0426
NP_441052.1_2 Reverse -316 -326 1.25834 0.249
NP_440436.1_4 Reverse -317 -326 8.55409 0.0997
NP_441884.1_9 Reverse -313 -332 -23.9933 0.284
NP_441884.1_9 Reverse -151 -170 -24.3866 0.286
NP_442864.1_7 Forward -331 -313 5.82068 0.274
NP_440314.1_9 Forward -302 -283 -9.63698 0.273
NP_441719.1_4 Forward -324 -317 6.82395 0.0855
NP_441719.1_4 Reverse -317 -324 6.52896 0.188
NP_442366.1_3 Forward -326 -308 -4.30741 0.268
NP_439949.1_7 Reverse -19 -33 11.406 0.288
NP_442873.1_5 Reverse -312 -331 15.3382 0.175
NP_442206.1_7 Forward -320 -301 10.3242 0.295
NP_442011.1_1 Forward -320 -301 0.196116 0.268
NP_441683.1_7 Reverse -329 -348 -7.67036 0.282
NP_441982.1_6 Reverse -10 -19 13.8222 0.274
NP_442450.1_5 Reverse -314 -324 10.0098 0.115
NP_440588.1_2 Reverse -307 -326 -2.55715 0.167
NP_441570.1_1 Forward -325 -307 -9.22396 0.132
NP_441078.1_4 Forward -12 -3 3.24465 0.145
NP_441078.1_4 Forward -325 -316 0.196389 0.205
NP_441078.1_4 Reverse -316 -325 -0.000272808 0.205
NP_442729.1_5 Reverse -299 -309 15.3197 0.199
NP_440707.1_9 Reverse -295 -314 0.982764 0.292
NP_442443.1_1 Reverse -295 -314 6.09597 0.155
NP_441432.1_8 Forward -326 -317 5.50626 0.151
NP_442320.1_8 Forward -331 -317 -4.7203 0.185
NP_442320.1_8 Reverse -111 -125 -5.90027 0.254
NP_441732.1_2 Reverse -312 -328 -17.346 0.253
NP_442797.1_7 Forward -332 -314 3.65739 0.234
NP_442797.1_7 Reverse -315 -333 2.87075 0.238
NP_441131.1_5 Reverse -299 -318 11.5042 0.155
NP_440199.1_10 Forward -328 -318 13.2547 0.108
NP_442751.1_4 Reverse -71 -90 13.1758 0.193
NP_442230.1_1 Forward -324 -305 25.6638 0.0121
NP_442230.1_2 Forward -108 -89 19.3698 0.0283
NP_442230.1_3 Forward -140 -121 17.6007 0.288
NP_441072.1_2 Reverse -299 -318 5.70265 0.296
NP_440713.1_4 Forward -329 -310 4.32602 0.231
NP_442489.1_2 Forward -336 -317 1.27776 0.293
NP_442489.1_7 Forward -325 -316 0.688044 0.152
NP_442489.1_7 Reverse -316 -325 0.688044 0.152
NP_440757.1_8 Reverse -210 -222 16.6995 0.185
NP_440559.1_1 Forward -324 -315 6.39124 0.134
NP_441659.2_8 Forward -325 -315 0.275027 0.27
NP_441040.1_5 Reverse -305 -324 15.1424 0.127
NP_442008.1_2 Reverse -301 -320 3.83436 0.245
NP_442008.1_2 Reverse -313 -332 3.6377 0.251
NP_442776.1_1 Reverse -355 -374 6.39097 0.228
NP_442346.1_5 Reverse -315 -325 4.3066 0.291
NP_440545.1_3 Reverse -312 -329 -4.58271 0.229
NP_442929.1_7 Reverse -309 -328 8.94757 0.276
NP_440831.1_3 Reverse -297 -316 8.23161 0.232
NP_440831.1_3 Reverse -307 -326 6.87253 0.27
NP_440831.1_3 Forward -334 -315 6.29006 0.275
NP_440831.1_3 Reverse -303 -322 6.09591 0.275
NP_441126.1_5 Forward -260 -241 2.3594 0.299
NP_440010.1_3 Reverse -317 -336 0.0977854 0.25
NP_442311.1_5 Reverse -297 -316 3.83436 0.245
NP_442603.1_7 Forward -325 -311 10.8154 0.125
NP_442603.1_7 Reverse -316 -330 8.55376 0.171
NP_442603.1_7 Forward -331 -317 5.80051 0.273
NP_442828.1_7 Reverse -327 -346 1.27776 0.276
NP_441833.1_4 Reverse -317 -324 6.52896 0.0924
NP_441833.1_4 Forward -324 -317 6.23397 0.163
NP_442162.1_9 Forward -324 -317 12.9205 0.0282
NP_442162.1_9 Reverse -317 -324 12.9205 0.0282
NP_440671.1_4 Reverse -310 -324 15.5359 0.0425
NP_442140.1_3 Reverse -317 -327 6.27322 0.176
NP_442140.1_3 Forward -78 -68 4.89658 0.238
NP_441813.1_5 Reverse -314 -324 12.9597 0.0182
NP_441813.1_5 Forward -327 -317 7.45319 0.0746
NP_440590.1_4 Reverse -317 -330 3.75586 0.0686
NP_440567.1_1 Reverse -317 -331 5.99778 0.0918
NP_442497.1_10 Forward -324 -315 1.08137 0.115
NP_442497.1_10 Reverse -317 -326 0.589713 0.153
NP_440821.1_4 Forward -327 -317 9.32148 0.03
NP_440821.1_4 Reverse -314 -324 7.64985 0.0679
NP_441239.1_9 Reverse -314 -326 12.7237 0.0433
NP_441951.1_4 Reverse -316 -335 24.2872 0.0227
NP_442270.1_9 Forward -330 -311 -11.7019 0.277
NP_440354.1_7 Reverse -316 -334 15.0638 0.167
NP_440354.1_7 Forward -331 -313 8.08229 0.251
NP_440546.1_4 Forward -325 -315 14.9908 0.0459
NP_440546.1_4 Reverse -316 -326 6.55553 0.291
NP_441230.1_5 Forward -330 -311 11.9958 0.082
NP_440462.1_4 Forward -326 -312 13.6676 0.169
NP_440462.1_6 Forward -327 -317 5.87989 0.135
NP_440462.1_6 Reverse -314 -324 3.91327 0.224
NP_442340.1_3 Reverse -251 -270 7.86593 0.107
NP_440868.1_4 Forward -329 -317 8.6921 0.0582
NP_440374.1_5 Reverse -239 -257 16.6371 0.197
NP_441474.1_1 Forward -304 -285 -3.34455 0.298
NP_442402.1_10 Reverse -126 -136 10.9926 0.272
NP_441848.1_4 Forward -259 -243 12.0388 0.213
NP_442039.1_4 Forward -324 -317 11.6422 0.0747
NP_442837.1_3 Forward -324 -317 6.0373 0.25
NP_442837.1_3 Reverse -317 -324 6.0373 0.25
NP_442053.1_1 Reverse -316 -325 14.4544 0.0114
NP_442053.1_1 Forward -325 -316 7.86621 0.0863
NP_440505.1_3 Forward -327 -317 12.2714 0.0543
NP_441102.1_1 Reverse -317 -336 3.83436 0.282
NP_441203.1_1 Forward -324 -305 -3.14714 0.0673
NP_441011.1_8 Forward -324 -315 9.24284 0.131
NP_441011.1_8 Reverse -317 -326 7.07956 0.179
NP_442533.1_1 Reverse -319 -338 -4.22878 0.14
NP_442533.1_1 Forward -328 -309 -15.8318 0.257
NP_442533.1_6 Reverse -316 -325 4.42462 0.179
NP_441482.1_7 Reverse -310 -324 17.6008 0.00517
NP_440116.1_8 Forward -324 -305 -5.70374 0.194
NP_439965.1_1 Reverse -307 -326 -7.86702 0.244
NP_441961.1_3 Forward -317 -298 15.3391 0.182
NP_441602.1_4 Forward -334 -315 9.93088 0.278
NP_441972.1_5 Forward -314 -295 -7.37537 0.248
NP_441106.1_1 Forward -326 -317 8.45619 0.0548
NP_441286.1_1 Forward -326 -314 3.97222 0.0397
NP_440670.1_6 Reverse -308 -327 13.2741 0.292
NP_440670.1_8 Forward -325 -316 8.75118 0.0606
NP_440670.1_8 Reverse -316 -325 6.19458 0.124
NP_441479.1_9 Reverse -322 -340 12.2122 0.297
NP_440886.1_7 Forward -338 -328 10.9926 0.0805
NP_440886.1_7 Forward -326 -316 6.86274 0.113
NP_440886.1_7 Reverse -315 -325 6.76441 0.114
NP_440886.1_7 Forward -332 -322 4.50281 0.232
NP_442614.1_2 Forward -325 -311 10.226 0.234
NP_442614.1_2 Reverse -300 -314 9.14437 0.242
NP_442614.1_2 Forward -79 -65 6.78443 0.285
NP_442072.1_9 Reverse -315 -333 -23.2853 0.288
NP_441753.1_10 Reverse -313 -332 2.85105 0.226
NP_440907.2_8 Reverse -317 -327 6.0761 0.179
NP_442061.1_8 Reverse -8 -22 15.9292 0.203
NP_441626.1_2 Forward -324 -317 12.2322 0.0511
NP_441626.1_2 Reverse -317 -324 5.93897 0.231
NP_442365.1_7 Reverse -312 -331 -4.13045 0.235
NP_440107.1_5 Forward -133 -114 -5.60541 0.216
NP_442794.1_1 Reverse -312 -324 9.28209 0.0795
NP_440387.1_1 Forward -325 -309 -5.74299 0.249
NP_440387.1_5 Forward -343 -324 10.8459 0.296
NP_441488.1_2 Reverse -181 -200 15.9291 0.26
NP_441488.1_7 Reverse -300 -319 1.76941 0.285
NP_441488.1_8 Forward -46 -32 7.47213 0.249
NP_442323.1_7 Forward -330 -311 4.52188 0.216
NP_441510.2_7 Forward -331 -317 14.1586 0.28
NP_440293.1_10 Reverse -291 -310 7.37428 0.183
NP_440766.1_4 Forward -329 -315 19.3708 0.0255
NP_440766.1_4 Reverse -312 -326 8.16106 0.0871
NP_440766.1_4 Reverse -318 -332 2.35953 0.187
NP_441979.1_5 Forward -337 -318 -10.9153 0.228
NP_441979.1_5 Reverse -310 -329 -11.8986 0.228
NP_441531.1_6 Reverse -313 -326 7.00078 0.3
NP_440457.1_1 Forward -329 -317 11.1504 0.092
NP_440798.1_6 Reverse -317 -330 5.13249 0.14
NP_442680.1_5 Forward -102 -83 2.31911 0.237
NP_441332.1_6 Forward -339 -329 14.0671 0.163
NP_442509.1_9 Forward -325 -315 13.1559 0.061
NP_442509.1_9 Reverse -316 -326 9.71433 0.192
NP_440554.1_4 Reverse -317 -327 11.6814 0.0377
NP_442737.1_5 Reverse -131 -150 11.5216 0.284
NP_441885.1_5 Forward -325 -315 -0.0199663 0.186
NP_441275.1_1 Reverse -127 -145 3.06741 0.189
NP_442341.1_7 Reverse -315 -329 7.27608 0.109
NP_442341.1_7 Forward -326 -312 1.67122 0.282
NP_442341.1_9 Forward -327 -313 17.4035 0.0269
NP_441756.1_5 Reverse -312 -331 -3.04881 0.287
NP_440076.1_5 Forward -332 -313 16.0265 0.159
NP_440507.2_3 Reverse -307 -326 6.98015 0.293
NP_441842.1_10 Forward -332 -318 17.7975 0.0203
NP_440275.1_3 Forward -327 -317 5.87989 0.13
NP_441190.1_1 Reverse -229 -248 7.17762 0.241
NP_440175.1_7 Forward -329 -311 9.26552 0.28
NP_440804.1_7 Reverse -146 -163 5.74131 0.291
NP_440149.1_8 Reverse -316 -335 9.14423 0.0554
NP_440216.1_1 Reverse -316 -330 -3.54032 0.0833
NP_440216.1_6 Forward -332 -316 5.86006 0.189
NP_440216.1_9 Forward -236 -227 6.39124 0.289
NP_440172.1_1 Forward -325 -315 7.55152 0.0761
NP_442015.1_10 Reverse -312 -325 10.1474 0.0402
NP_442015.1_10 Forward -329 -316 0.314277 0.231
NP_441226.1_7 Forward -324 -317 12.7234 0.0312
NP_441226.1_7 Reverse -317 -324 11.5435 0.0757
NP_441226.1_7 Reverse -323 -330 9.77352 0.131
NP_441111.1_7 Reverse -317 -325 8.86921 0.0589
NP_441766.1_2 Reverse -316 -325 14.7494 0.00772
NP_441766.1_9 Forward -333 -314 1.27776 0.246
NP_442417.1_5 Reverse -316 -330 10.6193 0.11
NP_442417.1_5 Reverse -322 -336 5.99778 0.241
NP_440416.1_9 Forward -332 -313 -7.96535 0.109
NP_440416.1_9 Forward -320 -301 -17.9951 0.25
NP_443052.1_9 Forward -342 -323 -4.22878 0.255
NP_442154.1_1 Reverse -292 -310 3.46073 0.0632
NP_442154.1_1 Reverse -301 -319 -14.1405 0.217
NP_442046.1_8 Reverse -311 -330 22.5172 0.0211
NP_440261.1_5 Reverse -71 -84 -3.61896 0.136
NP_440261.1_5 Reverse -317 -330 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCACACAGGAATACCGGCTTGTACTGCGACTTCTTTAACTGGGGAAGGGATTAACTTACTCCCCCTACCCCGACGGCGATCGGGCTGGCTCACCACCGCCAACACATCAATATCCGGGTGCCCCAAAAGAGCTTCCAGGGTAGGAACAGCAAAATCTGGTGTACCAAAGAAAACAGTTTTCATCACAAAATATCTAGAAAGTCTGCCCAGTTCATTACACCTTTAACTACCATGGTCTTAATTACCCTTAACAATGTAAAGAATTGTGAGAAACGGCATCTCTGCATTAATCCTTCTAGTGAATTAAAAGTACAATTCGGGCCGATAGTTAAGCAAATTACAACCAAGTACAGTCGTAGTTCATCGGACTAAATCTACCCTTTTTGAGGATATACCCCA

CDS

ATGGTTACCGAACAAGACCGTGAGTACATGCGCCAGGCGATCGCCATTATGAGGGATGCGGGGGTGGTCAACAAGACCGGCGGTCCCTTTGGCGTCGTGATTGTCAAAGACGGAGAAGTGATTGGGGCGGCCGGGAACAGTGTGATCCAAGATAATGATCCCTCTGCCCATGCGGAAGTCAATGCCATCCGGGAAGCTTGTAAAACCGTGGGTAGCTGGAACCTGGAAGGGGCGGTGATGTACAGCAGTTGTGAATGTTGCCCCATGTGCTACGCCACCAGCTATTGGGCCAGGATTGACAAAATTTACTACGCCGCTGGTTGGAGCGATTTTGAAGATCTCTTTGACGACAGTAACATCAGTAAAGACTTGGAAAAACCTTACCCCGAAAGACTGCTGGCACCGGAGCAAATTTTACAGGAAGAAGCCCAAGTAGTTTGGCAGGAATTTCGTCAGTTACCGGACGGTGCCCGCTATTAA

Protein

MVTEQDREYMRQAIAIMRDAGVVNKTGGPFGVVIVKDGEVIGAAGNSVIQDNDPSAHAEVNAIREACKTVGSWNLEGAVMYSSCECCPMCYATSYWARIDKIYYAAGWSDFEDLFDDSNISKDLEKPYPERLLAPEQILQEEAQVVWQEFRQLPDGARY