Your browser is old and dusty. Try Google Chrome!

Details for sll0047

ORF sll0047
Accession NP_442709.1
Symbol ycf12
Category hypothetical protein YCF12
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -105 -119 13.2743 0.0413
NP_441061.1_2 Forward -112 -98 10.0294 0.0651
NP_440557.1_1 Forward -112 -93 8.84924 0.125
NP_440557.1_1 Reverse -105 -124 4.52268 0.182
NP_440795.1_7 Forward -112 -105 14.6904 0.0123
NP_440795.1_7 Reverse -105 -112 14.6904 0.0123
NP_440795.1_7 Reverse -276 -283 12.2322 0.0614
NP_441418.1_1 Forward -345 -326 9.69201 0.205
NP_441418.1_6 Forward -113 -94 8.75091 0.00361
NP_441453.1_1 Reverse -97 -115 3.45998 0.264
NP_441453.1_4 Reverse -104 -112 16.539 0.00633
NP_441453.1_4 Forward -113 -105 16.539 0.00633
NP_441453.1_4 Forward -284 -276 14.4741 0.019
NP_441453.1_4 Reverse -275 -283 7.00092 0.107
NP_441453.1_4 Reverse -215 -223 4.24765 0.259
NP_442151.1_6 Reverse -104 -118 16.3225 0.0158
NP_440226.1_1 Forward -284 -265 4.71934 0.181
NP_441630.1_3 Forward -121 -102 -1.18052 0.293
NP_442655.1_10 Forward -116 -97 -9.73531 0.22
NP_442173.1_1 Forward -112 -104 15.4574 0.00633
NP_442173.1_1 Reverse -105 -113 15.4574 0.00633
NP_442173.1_1 Forward -283 -275 7.8859 0.134
NP_442173.1_1 Reverse -276 -284 5.62429 0.206
NP_442173.1_1 Reverse -216 -224 4.93597 0.241
NP_442752.1_4 Forward -113 -106 13.8055 0.0199
NP_442752.1_4 Reverse -104 -111 13.8055 0.0199
NP_442752.1_4 Forward -284 -277 4.26735 0.293
NP_443027.1_4 Forward -115 -105 15.3197 0.0437
NP_443027.1_4 Reverse -102 -112 14.828 0.0437
NP_443027.1_4 Reverse -273 -283 7.94484 0.223
NP_441812.1_3 Forward -285 -271 10.521 0.222
NP_442975.1_10 Reverse -271 -285 20.1568 0.00234
NP_442975.1_10 Reverse -100 -114 14.0603 0.0459
NP_442975.1_10 Forward -117 -103 12.192 0.0477
NP_440784.1_7 Forward -112 -105 15.9687 0.0123
NP_440784.1_7 Reverse -105 -112 15.9687 0.0123
NP_440784.1_7 Forward -283 -276 6.23397 0.241
NP_440784.1_7 Reverse -276 -283 6.23397 0.241
NP_440061.1_9 Forward -226 -212 7.96378 0.185
NP_440061.1_9 Reverse -179 -193 5.50552 0.283
NP_440061.1_9 Reverse -273 -287 4.91554 0.3
NP_441054.1_1 Forward -120 -106 14.6509 0.213
NP_441054.1_4 Reverse -205 -223 -0.7675 0.187
NP_441145.1_7 Forward -335 -316 7.7676 0.22
NP_441476.1_5 Forward -118 -99 -1.57384 0.205
NP_441476.1_5 Reverse -99 -118 -7.27704 0.285
NP_441499.1_3 Forward -273 -263 18.2691 0.28
NP_442062.1_3 Forward -334 -315 6.4893 0.182
NP_442062.1_8 Forward -113 -103 19.4496 0.000558
NP_442062.1_8 Reverse -215 -225 11.6814 0.0419
NP_442062.1_8 Reverse -104 -114 10.3048 0.0493
NP_442062.1_8 Reverse -275 -285 5.19158 0.181
NP_442062.1_8 Reverse -196 -206 4.0116 0.237
NP_440761.1_4 Forward -118 -99 -4.13045 0.132
NP_440304.1_4 Forward -115 -105 18.9579 0.00406
NP_440304.1_4 Reverse -102 -112 10.8948 0.051
NP_442242.1_4 Forward -112 -105 14.3954 0.0124
NP_442242.1_4 Reverse -105 -112 14.3954 0.0124
NP_442242.1_4 Forward -283 -276 11.8388 0.0776
NP_440044.1_8 Forward -283 -264 -1.18052 0.238
NP_441035.1_3 Reverse -241 -260 -0.590531 0.292
NP_439918.1_2 Forward -71 -52 -0.983855 0.236
NP_441352.1_2 Forward -120 -101 -0.39387 0.293
NP_441200.1_4 Forward -43 -24 7.47261 0.272
NP_441619.1_8 Forward -119 -105 6.48882 0.295
NP_441208.1_9 Forward -116 -102 11.8976 0.145
NP_441594.1_6 Forward -122 -103 24.3855 0.00681
NP_440370.1_10 Reverse -95 -114 15.3391 0.0867
NP_442110.1_7 Reverse -104 -118 18.9775 0.0138
NP_442110.1_7 Forward -113 -99 3.44117 0.21
NP_442110.1_7 Reverse -251 -265 0.392915 0.261
NP_440856.1_1 Forward -123 -104 3.83436 0.157
NP_440856.1_7 Reverse -245 -264 -8.85033 0.28
NP_440856.1_7 Forward -116 -97 -9.73531 0.297
NP_441083.1_5 Forward -113 -103 11.3864 0.0159
NP_441083.1_5 Reverse -104 -114 11.2881 0.0159
NP_441083.1_5 Reverse -275 -285 1.25834 0.213
NP_442827.1_8 Reverse -96 -115 5.50519 0.118
NP_442827.1_8 Forward -121 -102 0.195343 0.214
NP_441738.1_2 Forward -111 -104 15.28 0.0102
NP_441738.1_2 Reverse -106 -113 15.28 0.0102
NP_441558.1_5 Forward -115 -96 6.98095 0.198
NP_441955.1_8 Forward -230 -213 8.29864 0.259
NP_440209.1_1 Reverse -104 -112 18.1123 0.00295
NP_440209.1_1 Forward -113 -105 18.1123 0.00295
NP_440209.1_1 Forward -284 -276 8.37755 0.0576
NP_442889.1_1 Reverse -175 -194 -12.9802 0.242
NP_442889.1_8 Forward -116 -102 7.66879 0.143
NP_441713.1_1 Forward -290 -271 -17.0118 0.292
NP_441770.1_5 Forward -121 -102 11.0125 0.119
NP_440178.1_7 Reverse -103 -122 -13.6686 0.141
NP_440178.1_7 Forward -396 -377 -22.0267 0.249
NP_441716.1_1 Forward -113 -99 10.226 0.0968
NP_442111.1_4 Forward -114 -100 16.9125 0.0123
NP_442111.1_4 Reverse -103 -117 4.12949 0.219
NP_442111.1_5 Reverse -147 -166 11.7992 0.161
NP_440906.1_5 Forward -112 -105 15.8704 0.0124
NP_440906.1_5 Reverse -105 -112 15.8704 0.0124
NP_440906.1_5 Forward -283 -276 12.0355 0.0724
NP_440906.1_5 Reverse -276 -283 6.0373 0.262
NP_440747.1_10 Reverse -101 -113 7.70879 0.00236
NP_440747.1_10 Forward -287 -275 7.02048 0.0108
NP_440747.1_10 Forward -116 -104 -1.92764 0.0192
NP_441130.1_10 Reverse -102 -116 18.4858 0.0133
NP_441486.1_1 Forward -116 -102 2.45787 0.0831
NP_441486.1_1 Reverse -212 -226 -1.47537 0.172
NP_441486.1_1 Reverse -101 -115 -3.93365 0.184
NP_441486.1_1 Reverse -272 -286 -5.60527 0.248
NP_442634.1_4 Forward -115 -101 15.3392 0.0126
NP_442634.1_4 Forward -286 -272 -1.27871 0.149
NP_442634.1_4 Reverse -102 -116 -3.24533 0.161
NP_442634.1_4 Forward -355 -341 -5.70361 0.271
NP_440470.1_5 Forward -351 -332 6.44528 0.279
NP_440403.1_4 Reverse -95 -114 -6.88371 0.236
NP_440842.1_6 Forward -54 -35 11.7 0.259
NP_441014.1_10 Forward -114 -95 0.392004 0.243
NP_442848.1_1 Reverse -98 -112 7.9644 0.0791
NP_442848.1_1 Forward -119 -105 5.21113 0.0859
NP_442848.1_9 Forward -30 -11 2.85105 0.248
NP_441012.1_4 Forward -111 -98 10.1474 0.266
NP_441012.1_4 Reverse -100 -113 7.19745 0.272
NP_439978.1_1 Reverse -197 -213 9.98996 0.297
NP_443018.1_3 Forward -112 -105 14.8871 0.0123
NP_443018.1_3 Reverse -105 -112 14.8871 0.0123
NP_443018.1_3 Reverse -216 -223 10.7572 0.0907
NP_443018.1_3 Forward -283 -276 5.84064 0.174
NP_443018.1_3 Reverse -276 -283 5.54565 0.187
NP_443018.1_3 Forward -223 -216 4.56234 0.241
NP_441316.1_7 Reverse -102 -117 6.17475 0.107
NP_441634.1_8 Reverse -102 -116 2.35953 0.168
NP_440376.1_1 Forward -113 -104 19.4693 0.000692
NP_440376.1_1 Reverse -104 -113 19.4693 0.000692
NP_440376.1_1 Forward -284 -275 7.76787 0.0688
NP_440376.1_1 Reverse -16 -25 4.81794 0.149
NP_440376.1_1 Reverse -275 -284 -0.0986038 0.285
NP_441588.1_4 Reverse -106 -116 6.66654 0.185
NP_443065.1_6 Reverse -100 -119 4.71934 0.221
NP_442687.1_7 Reverse -103 -113 15.8113 0.0125
NP_442687.1_7 Forward -114 -104 9.02648 0.0994
NP_442687.1_7 Forward -285 -275 4.89658 0.23
NP_442687.1_7 Forward -295 -285 4.10993 0.266
NP_441077.1_2 Forward -335 -316 12.4613 0.114
NP_441077.1_6 Forward -341 -325 2.03061 0.29
NP_442485.1_3 Reverse -93 -112 -3.24547 0.272
NP_442485.1_3 Forward -207 -188 -4.03212 0.277
NP_442485.1_3 Forward -27 -8 -5.9004 0.296
NP_441846.1_10 Reverse -4 -23 -14.9469 0.241
NP_441422.1_7 Reverse -102 -119 5.84037 0.0992
NP_440360.1_5 Forward -52 -33 -1.57384 0.297
NP_440360.1_10 Reverse -106 -120 4.71948 0.227
NP_440360.1_10 Forward -80 -66 4.62115 0.227
NP_442658.1_1 Reverse -102 -112 15.9091 0.00966
NP_442658.1_1 Forward -115 -105 15.9091 0.00966
NP_442658.1_1 Forward -226 -216 12.5659 0.0526
NP_442658.1_1 Forward -192 -182 10.1076 0.132
NP_442198.1_7 Reverse -212 -231 11.405 0.209
NP_441855.2_4 Reverse -96 -115 11.7404 0.208
NP_441855.2_4 Forward -213 -194 9.52306 0.275
NP_442782.1_2 Forward -149 -135 10.7177 0.173
NP_442782.1_2 Forward -113 -99 0.88457 0.282
NP_442782.1_2 Forward -284 -270 0.294584 0.291
NP_442205.1_9 Forward -119 -103 1.14018 0.255
NP_442937.1_5 Forward -118 -99 10.1275 0.17
NP_442937.1_5 Reverse -381 -400 8.16093 0.231
NP_442321.1_1 Forward -115 -96 -3.54046 0.214
NP_441958.1_5 Forward -114 -104 21.2195 0.000805
NP_441958.1_5 Reverse -103 -113 12.2714 0.00183
NP_441958.1_5 Reverse -274 -284 1.65166 0.0872
NP_441958.1_5 Forward -285 -275 1.25834 0.108
NP_441127.1_1 Forward -119 -105 10.0294 0.262
NP_441127.1_5 Reverse -9 -28 15.9978 0.274
NP_439990.1_5 Forward -289 -276 14.2773 0.0889
NP_439990.1_5 Forward -118 -105 8.67241 0.166
NP_439990.1_5 Reverse -210 -223 5.62415 0.283
NP_442911.1_2 Reverse -94 -113 -2.95047 0.105
NP_442911.1_2 Reverse -6 -25 -8.26035 0.231
NP_442911.1_2 Reverse -295 -314 -10.7186 0.286
NP_440153.1_5 Forward -112 -98 7.17775 0.171
NP_440153.1_5 Reverse -105 -119 4.12949 0.199
NP_442064.1_4 Reverse -94 -113 10.815 0.192
NP_440993.1_2 Reverse -99 -115 9.20332 0.123
NP_440993.1_2 Forward -118 -102 4.87675 0.249
NP_439975.1_4 Reverse -132 -151 8.84924 0.281
NP_441348.1_3 Reverse -270 -289 6.4893 0.277
NP_441099.1_5 Forward -123 -104 -3.83545 0.139
NP_441099.1_5 Reverse -94 -113 -10.6203 0.258
NP_442002.1_9 Reverse -103 -110 10.7572 0.185
NP_440809.1_9 Reverse -266 -284 1.49411 0.121
NP_441646.1_1 Forward -279 -260 1.86774 0.227
NP_441646.1_1 Reverse -97 -116 0.58944 0.247
NP_442438.1_10 Reverse -99 -113 10.9143 0.0478
NP_442438.1_10 Forward -118 -104 9.43936 0.0637
NP_442438.1_10 Reverse -191 -205 1.17956 0.204
NP_442438.1_10 Reverse -11 -25 0.491246 0.225
NP_441000.1_6 Reverse -103 -117 -5.01529 0.257
NP_442771.1_1 Forward -115 -97 -6.96235 0.169
NP_442771.1_1 Reverse -102 -120 -8.24065 0.184
NP_440484.1_3 Forward -115 -101 10.6193 0.242
NP_440147.1_4 Reverse -102 -115 12.2123 0.0326
NP_440147.1_4 Reverse -273 -286 7.6891 0.064
NP_440147.1_4 Forward -27 -14 4.24752 0.167
NP_440147.1_4 Forward -115 -102 2.37923 0.208
NP_441550.1_8 Forward -115 -105 17.4824 0.00754
NP_441550.1_8 Reverse -102 -112 6.0761 0.214
NP_441550.1_8 Forward -286 -276 5.38779 0.252
NP_441916.1_7 Reverse -104 -114 18.9579 0.00144
NP_441916.1_7 Forward -113 -103 18.4663 0.00144
NP_441916.1_7 Forward -284 -274 13.8447 0.0172
NP_441916.1_7 Reverse -275 -285 1.16001 0.293
NP_440206.1_4 Reverse -99 -118 -1.57461 0.292
NP_440206.1_9 Forward -155 -136 18.4857 0.0834
NP_440465.1_10 Reverse -242 -261 -1.57384 0.295
NP_440465.1_10 Forward -116 -97 -1.57384 0.295
NP_441041.1_4 Forward -113 -94 1.96607 0.0769
NP_441041.1_7 Forward -116 -104 18.3015 0.00558
NP_441041.1_7 Reverse -101 -113 7.61196 0.162
NP_442642.1_9 Forward -120 -103 6.62702 0.192
NP_440569.1_6 Reverse -132 -151 5.99764 0.228
NP_442004.1_6 Reverse -104 -118 7.17775 0.165
NP_440703.1_9 Forward -190 -177 4.54195 0.296
NP_441725.1_4 Reverse -99 -113 3.63724 0.278
NP_441725.1_4 Forward -118 -104 3.14559 0.279
NP_441725.1_5 Forward -112 -102 11.2881 0.0247
NP_441725.1_5 Reverse -105 -115 8.92815 0.0553
NP_439966.1_7 Reverse -102 -112 18.4657 0.00473
NP_439966.1_7 Forward -115 -105 13.8442 0.0234
NP_439966.1_7 Forward -286 -276 5.58445 0.216
NP_439966.1_9 Forward -115 -106 0.983037 0.253
NP_439966.1_9 Reverse -102 -111 0.983037 0.253
NP_442941.1_3 Forward -112 -102 11.4848 0.0116
NP_442941.1_3 Reverse -105 -115 10.9931 0.0116
NP_442941.1_3 Reverse -276 -286 9.41981 0.0319
NP_442941.1_3 Forward -283 -273 7.64985 0.0628
NP_440289.1_2 Forward -116 -103 5.03416 0.0636
NP_440289.1_2 Reverse -101 -114 5.03416 0.0636
NP_440289.1_2 Reverse -302 -315 -2.34066 0.254
NP_440983.1_5 Reverse -50 -69 -8.94866 0.298
NP_442281.1_1 Reverse -99 -113 20.4518 0.00192
NP_442281.1_1 Forward -118 -104 13.5686 0.0256
NP_442281.1_1 Forward -195 -181 6.58715 0.122
NP_442281.1_1 Forward -319 -305 2.75226 0.257
NP_442281.1_1 Forward -229 -215 2.06395 0.278
NP_441334.1_7 Reverse -102 -121 -19.0768 0.275
NP_441334.1_7 Forward -115 -96 -19.1751 0.275
NP_442847.1_2 Reverse -68 -87 19.9606 0.147
NP_440437.1_1 Reverse -98 -117 -2.0655 0.21
NP_442500.1_8 Forward -331 -317 11.3353 0.261
NP_442012.1_1 Reverse -190 -209 -0.197208 0.253
NP_442012.1_1 Reverse -175 -194 -0.983855 0.272
NP_440723.1_10 Reverse -20 -39 16.7076 0.26
NP_440498.1_1 Reverse -95 -113 -1.55415 0.225
NP_441644.1_6 Reverse -104 -114 19.0557 0.000803
NP_441644.1_6 Forward -113 -103 10.1076 0.0628
NP_441644.1_6 Reverse -275 -285 5.58445 0.184
NP_442215.1_2 Forward -115 -99 -4.85801 0.24
NP_441810.1_9 Forward -120 -101 12.4875 0.0853
NP_440253.1_2 Forward -113 -95 11.6222 0.031
NP_440253.1_2 Forward -284 -266 -2.14413 0.261
NP_440929.1_8 Forward -113 -104 19.2726 0.000701
NP_440929.1_8 Reverse -104 -113 19.2726 0.000701
NP_441346.1_7 Reverse -190 -209 9.3409 0.284
NP_442933.1_10 Forward -113 -104 17.601 0.00325
NP_442933.1_10 Reverse -104 -113 17.601 0.00325
NP_442933.1_10 Forward -284 -275 7.96454 0.0937
NP_442933.1_10 Reverse -275 -284 7.76787 0.11
NP_442933.1_10 Forward -224 -215 4.52295 0.24
NP_441751.2_8 Reverse -105 -119 12.6843 0.0191
NP_441751.2_8 Forward -112 -98 -0.295402 0.125
NP_441751.2_8 Reverse -276 -290 -4.91696 0.187
NP_442926.1_4 Reverse -66 -84 18.3087 0.245
NP_442554.1_8 Reverse -105 -115 19.1546 0.00369
NP_442554.1_8 Forward -112 -102 13.8447 0.0145
NP_442554.1_8 Reverse -276 -286 6.96153 0.102
NP_441762.1_7 Reverse -103 -115 11.7404 0.0142
NP_441762.1_7 Forward -114 -102 2.98891 0.0676
NP_441762.1_7 Forward -206 -194 -7.53251 0.293
NP_442142.1_4 Reverse -101 -114 17.7182 0.0255
NP_442142.1_4 Forward -116 -103 14.1783 0.0311
NP_442142.1_4 Forward -287 -274 3.36198 0.258
NP_442292.1_1 Reverse -105 -114 17.5026 0.00435
NP_442292.1_1 Forward -112 -103 9.63616 0.0183
NP_442292.1_1 Reverse -276 -285 8.84951 0.0269
NP_442476.1_6 Forward -112 -98 -0.295402 0.294
NP_440895.1_10 Reverse -100 -117 -3.79607 0.187
NP_443009.1_5 Forward -114 -103 19.626 0.00102
NP_443009.1_5 Reverse -103 -114 7.82632 0.118
NP_443009.1_5 Reverse -214 -225 7.23633 0.135
NP_443009.1_5 Forward -295 -284 4.58141 0.239
NP_443009.1_5 Forward -285 -274 3.79477 0.278
NP_442741.1_7 Forward -52 -33 11.2092 0.271
NP_441715.1_4 Forward -112 -102 16.303 0.0117
NP_441715.1_4 Reverse -276 -286 7.55152 0.108
NP_441715.1_4 Reverse -105 -115 7.25653 0.108
NP_441198.1_8 Forward -115 -105 15.4199 0.0427
NP_441198.1_8 Forward -192 -182 12.5877 0.12
NP_441198.1_8 Reverse -273 -283 10.9275 0.232
NP_440379.1_5 Forward -122 -103 -10.0303 0.273
NP_441468.1_1 Forward -112 -105 15.8704 0.0124
NP_441468.1_1 Reverse -105 -112 15.8704 0.0124
NP_441468.1_1 Forward -283 -276 6.43063 0.175
NP_441468.1_1 Reverse -276 -283 6.0373 0.223
NP_441468.1_1 Forward -223 -216 4.07068 0.263
NP_441569.1_10 Forward -23 -5 17.9154 0.268
NP_441020.2_6 Forward -115 -98 21.0817 0.00372
NP_441020.2_6 Reverse -102 -119 7.11867 0.241
NP_441020.2_6 Reverse -194 -211 5.64371 0.293
NP_441015.1_7 Reverse -2 -21 13.0775 0.159
NP_441015.1_10 Forward -118 -99 5.30933 0.115
NP_441673.1_1 Forward -113 -104 20.8459 0.000698
NP_441673.1_1 Reverse -104 -113 20.8459 0.000698
NP_441673.1_1 Forward -284 -275 1.27803 0.155
NP_441673.1_1 Reverse -275 -284 1.27803 0.155
NP_441826.1_2 Reverse -98 -112 18.0925 0.0128
NP_441826.1_2 Forward -119 -105 7.07942 0.0899
NP_441826.1_2 Forward -290 -276 -4.62196 0.298
NP_441826.1_6 Forward -56 -42 12.291 0.295
NP_442490.1_2 Forward -161 -142 19.9207 0.224
NP_442868.1_6 Forward -286 -276 9.51814 0.0447
NP_442868.1_6 Forward -115 -105 8.63316 0.0555
NP_442868.1_6 Reverse -102 -112 0.963343 0.205
NP_442361.1_3 Reverse -98 -111 13.4906 0.142
NP_442808.1_1 Reverse -103 -113 18.4657 0.00201
NP_442808.1_1 Forward -114 -104 8.73102 0.0481
NP_442808.1_1 Forward -206 -196 6.27276 0.121
NP_442808.1_1 Forward -26 -16 4.99446 0.178
NP_441101.1_1 Forward -115 -97 7.98396 0.294
NP_442775.1_6 Forward -118 -99 9.73422 0.292
NP_440145.1_3 Forward -123 -104 7.47261 0.0466
NP_442820.1_4 Forward -175 -158 18.8201 0.265
NP_442718.1_1 Forward -224 -205 2.55606 0.295
NP_442542.1_2 Forward -115 -102 4.64084 0.299
NP_442113.1_10 Reverse -49 -68 -1.86883 0.205
NP_442050.1_5 Forward -115 -105 17.1874 0.00812
NP_442050.1_5 Reverse -273 -283 13.1559 0.0421
NP_442050.1_5 Reverse -102 -112 9.12434 0.193
NP_442342.1_9 Reverse -102 -118 10.5799 0.137
NP_441114.1_3 Forward -189 -180 7.37455 0.239
NP_441114.1_3 Reverse -183 -192 6.29291 0.285
NP_440558.1_2 Reverse -101 -120 -3.3438 0.234
NP_442789.1_4 Forward -54 -35 -7.17871 0.292
NP_441518.1_3 Forward -123 -104 -14.3569 0.275
NP_441878.1_6 Forward -114 -104 10.5014 0.0176
NP_441878.1_6 Reverse -103 -113 10.4031 0.0176
NP_441878.1_6 Reverse -15 -25 -7.29646 0.217
NP_441878.1_6 Reverse -304 -314 -7.49312 0.231
NP_441878.1_6 Forward -285 -275 -7.59145 0.245
NP_441036.1_8 Reverse -103 -113 17.7779 0.000554
NP_441036.1_8 Forward -114 -104 15.713 0.00724
NP_441036.1_8 Reverse -195 -205 11.9764 0.0989
NP_441036.1_8 Reverse -274 -284 5.5849 0.271
NP_442503.1_9 Reverse -15 -34 4.52268 0.294
NP_441534.1_5 Forward -220 -201 0.196116 0.293
NP_441557.1_5 Forward -113 -104 19.9609 0.000699
NP_441557.1_5 Reverse -104 -113 19.9609 0.000699
NP_441557.1_5 Forward -284 -275 8.94785 0.0289
NP_441557.1_5 Reverse -275 -284 0.688044 0.128
NP_441557.1_8 Forward -266 -256 10.9926 0.269
NP_441557.1_8 Forward -24 -14 10.3043 0.289
NP_441445.1_1 Reverse -266 -285 2.75272 0.229
NP_442066.2_4 Reverse -104 -123 9.24257 0.0742
NP_442066.2_9 Forward -117 -104 9.85238 0.159
NP_441433.1_8 Reverse -216 -235 -0.787193 0.251
NP_441308.1_8 Forward -115 -105 12.4681 0.218
NP_441308.1_8 Reverse -102 -112 10.1081 0.22
NP_441458.1_10 Forward -233 -214 3.93269 0.239
NP_442183.1_1 Forward -113 -99 19.1741 0.0065
NP_442183.1_1 Reverse -104 -118 17.5025 0.0107
NP_442632.1_1 Reverse -30 -49 12.4867 0.244
NP_441467.1_10 Reverse -326 -340 12.291 0.281
NP_442347.1_2 Forward -112 -103 11.1111 0.056
NP_442347.1_2 Reverse -105 -114 3.34298 0.284
NP_442645.1_2 Forward -115 -96 -20.1584 0.288
NP_442645.1_2 Reverse -8 -27 -21.24 0.29
NP_441037.1_4 Forward -115 -105 16.5761 0.0168
NP_441037.1_4 Reverse -102 -112 7.02532 0.237
NP_441037.1_4 Reverse -72 -82 6.24566 0.274
NP_442594.1_8 Forward -67 -48 2.0644 0.295
NP_442317.1_6 Reverse -99 -118 2.65439 0.274
NP_441633.1_3 Reverse -102 -115 5.91914 0.0481
NP_441633.1_3 Forward -115 -102 -5.88057 0.236
NP_440136.1_2 Forward -112 -105 15.9687 0.0123
NP_440136.1_2 Reverse -105 -112 15.9687 0.0123
NP_440136.1_2 Forward -283 -276 6.52896 0.116
NP_440136.1_2 Reverse -276 -283 6.13563 0.193
NP_442590.1_10 Reverse -98 -117 3.44104 0.293
NP_442998.1_10 Forward -111 -104 15.5754 0.0102
NP_442998.1_10 Reverse -106 -113 15.5754 0.0102
NP_442998.1_10 Reverse -277 -284 13.5105 0.0225
NP_442998.1_10 Reverse -307 -314 9.28223 0.117
NP_440299.1_1 Reverse -100 -113 20.1765 0.00128
NP_440299.1_1 Forward -288 -275 17.5216 0.0061
NP_440299.1_1 Reverse -52 -65 8.2785 0.0962
NP_440299.1_1 Forward -117 -104 4.44361 0.207
NP_441799.1_1 Reverse -211 -225 8.55376 0.112
NP_441799.1_1 Forward -117 -103 7.47213 0.141
NP_441799.1_1 Reverse -100 -114 5.01387 0.227
NP_441799.1_1 Forward -399 -385 3.63724 0.289
NP_440640.1_9 Reverse -89 -108 13.5691 0.281
NP_441007.1_10 Forward -118 -105 14.3756 0.0499
NP_440256.1_1 Forward -116 -97 11.4058 0.015
NP_440256.1_1 Reverse -101 -120 -2.55715 0.12
NP_440256.1_1 Forward -287 -268 -3.54046 0.135
NP_441362.1_5 Reverse -152 -170 10.9495 0.247
NP_441559.1_4 Reverse -179 -198 0.392778 0.297
NP_441559.1_8 Reverse -280 -294 3.34284 0.143
NP_441559.1_8 Reverse -99 -113 2.5562 0.143
NP_441559.1_8 Reverse -11 -25 0.589577 0.165
NP_441559.1_8 Forward -289 -275 -6.09693 0.274
NP_441559.1_8 Reverse -281 -295 -6.49025 0.279
NP_441559.1_8 Forward -118 -104 -7.47356 0.294
NP_442860.1_7 Forward -98 -80 7.06387 0.293
NP_440915.1_6 Reverse -100 -114 14.7492 0.0183
NP_440915.1_6 Forward -117 -103 14.0609 0.0187
NP_440915.1_6 Forward -288 -274 1.17956 0.145
NP_441704.1_8 Reverse -93 -112 6.78348 0.258
NP_442866.1_1 Forward -118 -99 -3.83545 0.222
NP_440306.1_8 Forward -241 -222 -2.55791 0.264
NP_440695.1_5 Reverse -215 -234 -0.000545616 0.284
NP_440695.1_5 Forward -113 -94 -2.0655 0.296
NP_440695.1_6 Reverse -312 -326 17.5862 0.126
NP_441939.1_3 Reverse -105 -124 14.5524 0.0756
NP_441939.1_3 Reverse -182 -201 6.19431 0.248
NP_441199.1_6 Reverse -100 -119 24.0905 0.00942
NP_441494.1_6 Forward -118 -105 9.85238 0.227
NP_442993.1_1 Forward -284 -268 0.845183 0.0609
NP_442993.1_1 Reverse -104 -120 -1.12144 0.0876
NP_442386.1_9 Reverse -103 -112 15.7322 0.0144
NP_442386.1_9 Forward -225 -216 10.914 0.111
NP_442386.1_9 Forward -114 -105 6.39082 0.219
NP_440570.1_5 Forward -129 -110 -1.47551 0.273
NP_441750.1_4 Reverse -100 -119 3.83436 0.23
NP_441340.1_5 Forward -112 -105 15.6737 0.0124
NP_441340.1_5 Reverse -105 -112 15.6737 0.0124
NP_441340.1_5 Forward -283 -276 13.2155 0.0437
NP_441340.1_5 Reverse -276 -283 6.13563 0.175
NP_441340.1_5 Reverse -216 -223 3.97235 0.274
NP_441947.1_3 Reverse -23 -41 16.2438 0.18
NP_441947.1_10 Reverse -102 -120 2.96908 0.276
NP_442791.1_5 Forward -302 -283 -10.522 0.279
NP_442240.1_2 Reverse -105 -124 -13.0786 0.163
NP_442240.1_2 Forward -112 -93 -14.4552 0.18
NP_440161.1_3 Reverse -213 -232 16.2241 0.084
NP_440586.1_1 Forward -120 -101 3.14605 0.212
NP_440586.1_8 Forward -112 -105 13.2151 0.026
NP_440586.1_8 Reverse -105 -112 13.2151 0.026
NP_442874.1_6 Reverse -180 -199 11.0125 0.254
NP_442251.1_6 Forward -112 -105 15.2804 0.0124
NP_442251.1_6 Reverse -105 -112 15.2804 0.0124
NP_441262.1_3 Reverse -104 -111 14.7888 0.0223
NP_441262.1_3 Forward -113 -106 14.7888 0.0223
NP_441262.1_3 Forward -284 -277 5.25066 0.215
NP_440027.1_3 Forward -86 -68 4.34495 0.262
NP_440027.1_8 Reverse -101 -120 6.78348 0.27
NP_443051.1_1 Forward -114 -105 19.5676 0.00335
NP_443051.1_1 Reverse -103 -112 10.4228 0.00754
NP_443051.1_1 Forward -285 -276 0.688044 0.134
NP_443051.1_1 Reverse -274 -283 0.393051 0.169
NP_439937.1_8 Reverse -102 -121 0.491109 0.235
NP_439937.1_8 Forward -115 -96 -4.03212 0.276
NP_439937.1_9 Reverse -103 -120 -8.51661 0.176
NP_439937.1_9 Forward -206 -189 -10.7782 0.233
NP_439937.1_9 Reverse -25 -42 -11.3682 0.251
NP_440408.1_3 Forward -119 -100 0.786102 0.204
NP_440408.1_10 Forward -119 -100 8.35759 0.176
NP_440439.1_1 Reverse -101 -114 15.2606 0.0137
NP_440439.1_1 Forward -116 -103 10.344 0.0369
NP_440439.1_1 Forward -287 -274 -0.177378 0.209
NP_442239.1_8 Forward -119 -100 7.66927 0.255
NP_440372.1_2 Forward -112 -105 16.3621 0.0124
NP_440372.1_2 Reverse -105 -112 16.3621 0.0124
NP_440372.1_2 Forward -283 -276 6.62729 0.151
NP_440372.1_2 Reverse -276 -283 6.52896 0.188
NP_440819.1_5 Forward -150 -142 7.59091 0.272
NP_441293.1_2 Reverse -107 -126 16.5191 0.217
NP_441803.1_2 Reverse -99 -118 17.6007 0.0309
NP_439977.1_5 Forward -119 -100 5.11266 0.15
NP_439977.1_5 Reverse -98 -117 4.22769 0.154
NP_441572.1_7 Forward -119 -100 3.24438 0.119
NP_442384.1_10 Forward -113 -100 15.7522 0.00946
NP_442384.1_10 Reverse -275 -288 10.5407 0.0439
NP_442384.1_10 Reverse -104 -117 1.9859 0.24
NP_441877.1_7 Reverse -99 -118 7.57013 0.218
NP_441877.1_7 Forward -124 -105 -0.29631 0.283
NP_441018.1_5 Reverse -163 -182 17.2074 0.233
NP_441018.1_7 Forward -117 -98 10.0292 0.218
NP_441018.1_7 Reverse -177 -196 8.65258 0.241
NP_442790.1_4 Reverse -95 -114 -13.6686 0.266
NP_442262.1_10 Forward -112 -105 14.1988 0.0123
NP_442262.1_10 Reverse -105 -112 14.1988 0.0123
NP_442262.1_10 Forward -283 -276 10.4622 0.145
NP_442262.1_10 Reverse -216 -223 9.87221 0.164
NP_441689.1_5 Reverse -273 -283 10.501 0.132
NP_441689.1_5 Reverse -102 -112 8.53436 0.132
NP_441689.1_5 Forward -115 -105 8.43603 0.132
NP_440163.1_10 Reverse -101 -111 16.303 0.0762
NP_440344.1_10 Forward -120 -103 9.77361 0.00808
NP_440344.1_10 Reverse -97 -114 0.530496 0.0353
NP_441060.1_6 Forward -196 -180 14.4149 0.254
NP_440189.1_2 Forward -121 -102 2.26107 0.268
NP_440189.1_2 Reverse -69 -88 -0.787193 0.293
NP_441965.1_10 Forward -116 -100 8.22001 0.131
NP_440297.1_9 Forward -112 -102 9.32148 0.0917
NP_440297.1_9 Reverse -105 -115 -0.314959 0.282
NP_441896.1_3 Reverse -95 -114 3.04771 0.179
NP_441896.1_3 Reverse -187 -206 -1.86883 0.268
NP_440894.1_10 Reverse -99 -118 11.6025 0.142
NP_440999.1_2 Reverse -252 -271 12.6841 0.19
NP_440999.1_9 Reverse -100 -114 10.6193 0.0502
NP_440999.1_9 Forward -117 -103 4.91614 0.114
NP_440888.1_2 Reverse -104 -118 18.1901 0.00261
NP_440888.1_2 Forward -113 -99 14.9452 0.0137
NP_440888.1_2 Reverse -110 -124 6.48882 0.232
NP_440888.1_2 Forward -25 -11 5.40719 0.28
NP_440888.1_2 Reverse -275 -289 5.21053 0.288
NP_440491.1_1 Reverse -101 -120 12.9594 0.137
NP_442948.1_2 Forward -114 -95 17.7974 0.0953
NP_442277.1_4 Forward -122 -103 1.08032 0.286
NP_442033.1_10 Reverse -102 -121 -14.4552 0.298
NP_441543.1_2 Forward -112 -103 18.486 0.00236
NP_441543.1_2 Reverse -105 -114 15.9293 0.00518
NP_441543.1_2 Reverse -276 -285 15.3394 0.00889
NP_441543.1_2 Forward -283 -274 9.83282 0.0818
NP_441543.1_2 Forward -253 -244 5.70292 0.181
NP_442845.1_2 Forward -119 -105 14.9459 0.0763
NP_440208.1_1 Forward -28 -9 -10.3253 0.257
NP_441469.1_8 Reverse -103 -112 16.126 0.00797
NP_441469.1_8 Forward -114 -105 6.5879 0.227
NP_442315.1_2 Reverse -177 -189 10.8554 0.291
NP_443064.1_6 Reverse -104 -114 10.8217 0.13
NP_441306.1_10 Reverse -138 -152 15.9285 0.247
NP_442578.1_7 Forward -112 -105 14.5921 0.026
NP_442578.1_7 Reverse -105 -112 14.5921 0.026
NP_442578.1_7 Forward -283 -276 11.3472 0.102
NP_441462.1_2 Reverse -104 -114 20.2362 0.000805
NP_441462.1_2 Forward -113 -103 11.5831 0.00406
NP_441462.1_2 Forward -284 -274 9.51814 0.0171
NP_441621.1_7 Forward -115 -101 6.48943 0.068
NP_441621.1_7 Reverse -102 -116 4.22782 0.0934
NP_443062.1_1 Reverse -104 -122 7.86337 0.166
NP_443062.1_1 Forward -284 -266 7.57085 0.172
NP_443062.1_1 Reverse -275 -293 3.37804 0.3
NP_443062.1_6 Reverse -96 -115 8.65258 0.14
NP_443062.1_6 Forward -232 -213 0.294447 0.299
NP_441410.1_4 Forward -275 -256 7.76679 0.297
NP_442204.1_1 Reverse -100 -111 9.69511 0.0736
NP_442204.1_1 Forward -288 -277 3.40192 0.266
NP_442204.1_1 Forward -117 -106 2.61528 0.266
NP_442204.1_1 Reverse -1 -12 -0.432984 0.299
NP_442204.1_5 Forward -123 -104 1.57275 0.232
NP_441560.1_10 Reverse -96 -115 5.50599 0.292
NP_440516.1_8 Forward -113 -104 16.9127 0.00442
NP_440516.1_8 Reverse -104 -113 16.9127 0.00442
NP_440516.1_8 Forward -284 -275 -0.295266 0.232
NP_442428.1_5 Forward -112 -105 15.8704 0.0124
NP_442428.1_5 Reverse -105 -112 15.8704 0.0124
NP_442428.1_5 Forward -283 -276 6.52896 0.109
NP_442428.1_5 Reverse -276 -283 6.0373 0.212
NP_442428.1_5 Forward -223 -216 4.46401 0.267
NP_442859.1_2 Reverse -105 -124 6.09597 0.199
NP_442120.1_10 Forward -119 -100 -3.73712 0.199
NP_442120.1_10 Forward -284 -265 -14.5535 0.288
NP_440673.1_3 Forward -111 -104 12.4288 0.0426
NP_440673.1_3 Reverse -106 -113 12.4288 0.0426
NP_440673.1_3 Reverse -217 -224 10.5605 0.123
NP_441714.1_3 Forward -120 -102 14.2763 0.191
NP_440865.1_9 Forward -119 -100 11.3075 0.0497
NP_440865.1_9 Reverse -269 -288 -1.08219 0.173
NP_441052.1_2 Forward -113 -103 10.5014 0.0285
NP_441052.1_2 Reverse -104 -114 10.4031 0.0285
NP_441052.1_2 Reverse -275 -285 8.23984 0.0482
NP_442219.1_9 Forward -112 -103 8.35786 0.0681
NP_442219.1_9 Reverse -105 -114 8.25953 0.0681
NP_442219.1_9 Reverse -276 -285 7.96454 0.0696
NP_440436.1_4 Forward -112 -103 18.1905 0.00233
NP_440436.1_4 Reverse -216 -225 10.7174 0.0743
NP_440436.1_4 Reverse -105 -114 9.24241 0.0871
NP_440436.1_4 Reverse -276 -285 7.57079 0.124
NP_441884.1_8 Reverse -103 -122 -10.3253 0.268
NP_441884.1_9 Forward -116 -97 -14.0619 0.138
NP_441884.1_9 Forward -208 -189 -21.9284 0.272
NP_441884.1_9 Forward -55 -36 -22.9117 0.284
NP_440041.1_6 Reverse -130 -149 14.0599 0.285
NP_441719.1_4 Forward -112 -105 16.3621 0.0124
NP_441719.1_4 Reverse -105 -112 16.3621 0.0124
NP_441719.1_4 Forward -283 -276 6.62729 0.151
NP_441719.1_4 Reverse -276 -283 6.52896 0.188
NP_441733.1_10 Forward -116 -103 18.1122 0.0292
NP_441004.1_1 Forward -119 -100 1.37609 0.111
NP_442366.1_3 Reverse -103 -121 7.00065 0.0772
NP_442366.1_3 Reverse -214 -232 0.314141 0.173
NP_440129.1_10 Reverse -97 -111 6.29277 0.177
NP_441115.1_4 Reverse -103 -121 14.9646 0.0464
NP_442694.1_8 Forward -234 -216 12.9988 0.191
NP_442206.1_10 Forward -113 -98 11.583 0.1
NP_443054.1_2 Reverse -102 -116 12.4876 0.0722
NP_442430.1_10 Forward -123 -104 17.4032 0.0779
NP_441851.1_10 Reverse -103 -113 16.008 0.00552
NP_441851.1_10 Forward -114 -104 8.53483 0.114
NP_441851.1_10 Forward -285 -275 8.04317 0.124
NP_442814.1_6 Reverse -176 -195 12.4875 0.253
NP_440593.1_3 Forward -118 -99 -2.95047 0.229
NP_440463.1_6 Reverse -101 -120 12.0942 0.157
NP_440165.1_5 Reverse -103 -122 -0.787193 0.181
NP_442709.1_2 Forward -87 -68 33.1361 0.0000747
NP_442709.1_3 Forward -21 -2 22.1239 0.0161
NP_442709.1_5 Forward -162 -143 27.0405 0.00427
NP_442709.1_6 Forward -48 -29 24.5822 0.021
NP_442709.1_7 Forward -183 -164 29.2028 0.000574
NP_442709.1_10 Forward -141 -122 25.4672 0.0132
NP_440940.1_7 Reverse -94 -112 11.4247 0.112
NP_441349.1_10 Forward -324 -305 9.73422 0.0238
NP_441349.1_10 Forward -123 -104 -1.18052 0.0999
NP_441349.1_10 Reverse -265 -284 -6.39206 0.228
NP_441409.1_6 Reverse -299 -318 -0.197208 0.0678
NP_441409.1_6 Reverse -98 -117 -8.35868 0.167
NP_441409.1_6 Forward -290 -271 -9.83364 0.194
NP_441409.1_6 Reverse -269 -288 -13.8652 0.244
NP_440389.1_3 Reverse -13 -32 13.4708 0.232
NP_442843.1_1 Forward -189 -170 -3.24547 0.222
NP_440474.1_8 Reverse -105 -119 11.602 0.103
NP_440431.1_3 Reverse -274 -293 -5.01543 0.18
NP_442450.1_3 Forward -338 -320 7.19654 0.211
NP_442450.1_5 Reverse -102 -112 9.32148 0.115
NP_440588.1_2 Forward -122 -103 -0.885524 0.154
NP_442006.1_2 Reverse -187 -204 -14.8091 0.21
NP_441570.1_1 Forward -113 -95 2.28076 0.0252
NP_441570.1_1 Reverse -104 -122 -8.83064 0.122
NP_440078.1_10 Forward -113 -94 4.71934 0.243
NP_441078.1_4 Forward -113 -104 19.6659 0.0007
NP_441078.1_4 Reverse -104 -113 19.6659 0.0007
NP_441078.1_4 Reverse -275 -284 8.35786 0.0338
NP_441078.1_4 Forward -284 -275 7.27622 0.0764
NP_441078.1_4 Forward -314 -305 -1.27858 0.246
NP_441078.1_4 Reverse -16 -25 -1.86856 0.272
NP_442729.1_8 Reverse -100 -113 8.08242 0.125
NP_441663.1_3 Reverse -134 -153 23.2056 0.0183
NP_441663.1_5 Reverse -113 -132 22.8699 0.0481
NP_441663.1_7 Reverse -248 -267 5.60432 0.236
NP_441663.1_8 Reverse -188 -207 -3.24547 0.28
NP_442443.1_1 Reverse -8 -27 -1.96717 0.246
NP_440526.1_3 Reverse -105 -116 11.6612 0.0646
NP_441432.1_8 Forward -114 -105 16.8143 0.00595
NP_441432.1_8 Reverse -103 -112 8.25953 0.0755
NP_441432.1_8 Forward -285 -276 7.27622 0.101
NP_441432.1_8 Reverse -274 -283 5.80125 0.137
NP_441432.1_9 Reverse -318 -331 16.0641 0.121
NP_442320.1_8 Forward -119 -105 7.66941 0.0189
NP_442320.1_8 Reverse -98 -112 4.71948 0.0472
NP_442320.1_8 Reverse -269 -283 -3.83532 0.134
NP_441732.1_2 Reverse -100 -116 2.12349 0.0253
NP_441732.1_2 Forward -117 -101 -15.1828 0.145
NP_441732.1_2 Reverse -39 -55 -16.6577 0.186
NP_440685.1_6 Forward -287 -268 17.0099 0.217
NP_440760.1_1 Reverse -104 -123 -12.0953 0.091
NP_442274.1_4 Forward -253 -234 15.3391 0.221
NP_440131.1_4 Reverse -55 -74 4.22769 0.275
NP_440199.1_10 Forward -317 -307 9.02648 0.215
NP_440199.1_10 Forward -221 -211 7.15819 0.235
NP_440913.1_1 Forward -115 -97 6.01734 0.231
NP_442751.1_2 Forward -26 -7 2.9486 0.274
NP_440713.1_4 Forward -123 -104 1.96607 0.273
NP_442489.1_7 Forward -113 -104 20.1576 0.000695
NP_442489.1_7 Reverse -104 -113 20.1576 0.000695
NP_442489.1_7 Forward -284 -275 1.08137 0.109
NP_442489.1_7 Reverse -275 -284 0.589713 0.17
NP_442489.1_7 Reverse -16 -25 -1.37691 0.195
NP_442489.1_7 Reverse -305 -314 -1.6719 0.235
NP_442489.1_7 Forward -205 -196 -1.96689 0.28
NP_442079.1_7 Forward -112 -93 6.19431 0.162
NP_440559.1_1 Forward -112 -103 8.75118 0.0586
NP_440559.1_1 Reverse -105 -114 8.65285 0.0586
NP_440559.1_1 Reverse -276 -285 7.76787 0.0918
NP_440559.1_1 Forward -223 -214 4.52295 0.26
NP_441659.2_8 Reverse -104 -114 20.9245 0.000805
NP_441659.2_8 Forward -113 -103 11.9764 0.0147
NP_441659.2_8 Reverse -275 -285 6.37155 0.0774
NP_441659.2_8 Forward -284 -274 1.55333 0.238
NP_441659.2_8 Forward -86 -76 -0.216628 0.292
NP_440860.1_8 Forward -115 -96 14.8474 0.288
NP_439956.1_7 Reverse -176 -195 3.73603 0.257
NP_441800.1_7 Forward -30 -12 0.707465 0.21
NP_442346.1_5 Forward -114 -104 16.303 0.00248
NP_442346.1_5 Reverse -274 -284 10.4031 0.0967
NP_442346.1_5 Reverse -103 -113 9.02648 0.118
NP_442346.1_5 Forward -285 -275 7.15819 0.178
NP_440352.1_7 Forward -394 -381 15.6533 0.26
NP_440545.1_3 Forward -117 -100 15.1818 0.0136
NP_440545.1_3 Reverse -100 -117 1.02215 0.127
NP_440545.1_3 Forward -41 -24 -3.50107 0.206
NP_440545.1_3 Reverse -241 -258 -4.18939 0.22
NP_440545.1_3 Forward -258 -241 -4.97604 0.237
NP_441856.1_3 Forward -287 -268 -2.36049 0.26
NP_440743.1_8 Forward -283 -264 13.7649 0.244
NP_440486.1_6 Forward -114 -95 5.99764 0.284
NP_440010.1_4 Forward -123 -104 -3.24622 0.294
NP_441943.1_8 Forward -200 -181 -5.50708 0.261
NP_442603.1_7 Forward -113 -99 8.3571 0.176
NP_442603.1_7 Reverse -275 -289 5.60385 0.284
NP_441585.1_5 Forward -31 -12 6.98015 0.211
NP_441888.1_7 Reverse -99 -113 13.3726 0.0743
NP_441888.1_8 Reverse -10 -29 9.83255 0.28
NP_440449.1_6 Forward -121 -103 13.6053 0.105
NP_441948.1_4 Reverse -97 -115 -1.75081 0.152
NP_441833.1_4 Forward -112 -105 15.9687 0.0124
NP_441833.1_4 Reverse -105 -112 15.9687 0.0124
NP_441833.1_4 Forward -283 -276 6.23397 0.163
NP_441833.1_4 Reverse -276 -283 6.13563 0.198
NP_443040.1_1 Forward -333 -319 14.5324 0.276
NP_441895.1_2 Forward -154 -135 -17.7001 0.234
NP_442699.1_8 Reverse -78 -97 -11.8986 0.238
NP_442162.1_9 Forward -112 -105 16.2637 0.0124
NP_442162.1_9 Reverse -105 -112 16.2637 0.0124
NP_442162.1_9 Forward -283 -276 6.62729 0.142
NP_442162.1_9 Reverse -276 -283 6.43063 0.208
NP_442162.1_10 Forward -54 -35 17.093 0.209
NP_440671.1_4 Reverse -98 -112 20.7474 0.00558
NP_440671.1_4 Forward -119 -105 9.43936 0.184
NP_440671.1_4 Forward -24 -10 9.34103 0.184
NP_442140.1_3 Forward -112 -102 8.33817 0.119
NP_442140.1_3 Reverse -105 -115 7.94484 0.124
NP_440875.1_9 Reverse -106 -116 16.8403 0.0145
NP_440875.1_9 Forward -111 -101 9.05339 0.233
NP_441813.1_5 Reverse -102 -112 17.188 0.00979
NP_441813.1_5 Forward -115 -105 8.73149 0.0367
NP_441813.1_5 Forward -286 -276 8.4365 0.0432
NP_441813.1_5 Reverse -273 -283 5.28991 0.138
NP_440590.1_4 Reverse -105 -118 12.704 0.013
NP_440590.1_4 Reverse -276 -289 4.93583 0.0585
NP_440590.1_4 Forward -112 -99 -2.24233 0.239
NP_440567.1_1 Reverse -105 -119 16.1259 0.0166
NP_440567.1_1 Forward -112 -98 5.01447 0.108
NP_442497.1_10 Reverse -105 -114 17.601 0.00813
NP_442497.1_10 Forward -112 -103 10.4228 0.0087
NP_442497.1_10 Forward -283 -274 5.99792 0.095
NP_442497.1_10 Reverse -276 -285 0.589713 0.153
NP_440821.1_4 Reverse -102 -112 19.0562 0.00399
NP_440821.1_4 Forward -115 -105 10.7964 0.0146
NP_440821.1_4 Forward -286 -276 -0.314959 0.251
NP_441239.1_9 Forward -115 -103 17.4436 0.0146
NP_441239.1_9 Reverse -102 -114 13.3137 0.037
NP_441239.1_9 Forward -226 -214 5.25052 0.223
NP_441239.1_9 Reverse -14 -26 3.08724 0.296
NP_441951.1_4 Reverse -3 -22 0.294447 0.297
NP_441727.1_3 Forward -120 -101 6.09597 0.246
NP_441892.1_1 Forward -122 -105 14.1002 0.034
NP_441892.1_1 Forward -357 -340 1.8088 0.147
NP_442044.1_1 Reverse -23 -42 -14.4552 0.291
NP_442044.1_1 Forward -118 -99 -14.5535 0.291
NP_442044.1_9 Forward -113 -94 1.67108 0.287
NP_442193.1_1 Reverse -181 -199 13.8838 0.203
NP_442193.1_8 Reverse -101 -120 12.88 0.234
NP_442216.1_4 Forward -271 -263 17.6202 0.23
NP_440949.1_7 Reverse -96 -115 12.585 0.214
NP_442138.1_10 Forward -113 -94 -2.45882 0.207
NP_442052.1_8 Forward -192 -182 11.9764 0.297
NP_440546.1_4 Reverse -104 -114 13.5365 0.0459
NP_440546.1_4 Forward -284 -274 12.373 0.0679
NP_440546.1_4 Forward -113 -103 11.8882 0.0679
NP_440546.1_4 Reverse -275 -285 7.62206 0.23
NP_440546.1_6 Reverse -94 -113 8.84924 0.253
NP_441230.1_5 Forward -118 -99 17.109 0.0583
NP_440462.1_6 Forward -115 -105 19.4496 0.00371
NP_440462.1_6 Reverse -102 -112 15.418 0.0142
NP_440462.1_6 Reverse -273 -283 6.37155 0.118
NP_442611.1_1 Forward -118 -99 -0.000545616 0.265
NP_440868.1_4 Reverse -100 -112 8.6921 0.0582
NP_440868.1_4 Forward -117 -105 0.432302 0.212
NP_442402.1_10 Forward -233 -223 10.9926 0.272
NP_442460.1_3 Forward -52 -33 11.7008 0.256
NP_442039.1_4 Forward -112 -105 15.1821 0.0124
NP_442039.1_4 Reverse -105 -112 15.1821 0.0124
NP_442039.1_4 Forward -283 -276 12.1338 0.063
NP_442837.1_3 Forward -112 -105 15.7721 0.0124
NP_442837.1_3 Reverse -105 -112 15.7721 0.0124
NP_442837.1_3 Forward -283 -276 6.0373 0.25
NP_442837.1_3 Reverse -276 -283 5.93897 0.265
NP_442053.1_1 Forward -113 -104 18.3876 0.0007
NP_442053.1_1 Reverse -104 -113 18.3876 0.0007
NP_442053.1_1 Forward -205 -196 3.7363 0.29
NP_440505.1_3 Forward -286 -276 16.893 0.00577
NP_440505.1_3 Forward -115 -105 15.418 0.0114
NP_440505.1_3 Reverse -102 -112 13.8447 0.0247
NP_440505.1_7 Reverse -12 -31 -2.45882 0.289
NP_442532.1_7 Reverse -104 -118 6.88276 0.171
NP_443053.1_1 Reverse -19 -38 24.3855 0.0236
NP_442174.1_9 Forward -115 -96 20.5506 0.146
NP_440914.1_1 Reverse -104 -114 16.3248 0.00196
NP_440914.1_1 Forward -190 -180 10.3717 0.142
NP_440914.1_1 Forward -113 -103 8.6151 0.186
NP_440914.1_1 Reverse -275 -285 6.85846 0.263
NP_441011.1_8 Forward -112 -103 16.9127 0.00602
NP_441011.1_8 Reverse -105 -114 16.6177 0.00602
NP_441011.1_8 Forward -283 -274 8.25953 0.144
NP_441011.1_8 Reverse -276 -285 5.50626 0.256
NP_442533.1_6 Forward -113 -104 17.2076 0.00137
NP_442533.1_6 Reverse -104 -113 17.2076 0.00137
NP_442533.1_6 Forward -284 -275 5.99792 0.121
NP_442533.1_6 Forward -395 -386 2.75299 0.241
NP_442541.1_10 Forward -396 -382 6.48882 0.248
NP_442541.1_10 Forward -25 -11 2.5556 0.255
NP_442232.1_3 Forward -121 -102 -3.24547 0.163
NP_442322.1_4 Forward -28 -11 -8.51661 0.286
NP_442229.1_1 Forward -115 -101 7.96378 0.189
NP_441482.1_7 Reverse -98 -112 17.6992 0.00499
NP_441482.1_7 Forward -119 -105 -0.688726 0.0612
NP_441482.1_7 Forward -290 -276 -0.885388 0.0612
NP_439944.1_9 Reverse -105 -115 17.7779 0.00341
NP_439944.1_9 Forward -112 -102 10.3048 0.0887
NP_439944.1_9 Reverse -276 -286 7.74818 0.131
NP_439944.1_9 Forward -283 -273 6.46988 0.179
NP_442202.1_2 Reverse -190 -209 17.7965 0.244
NP_440116.1_8 Reverse -276 -295 -3.83545 0.158
NP_440115.1_6 Forward -116 -106 7.84651 0.146
NP_440115.1_6 Forward -287 -277 6.27322 0.191
NP_440115.1_6 Forward -193 -183 4.60159 0.293
NP_440007.1_9 Reverse -100 -114 4.32615 0.267
NP_440007.1_9 Forward -288 -274 0.88457 0.29
NP_441680.1_4 Reverse -1 -20 2.0644 0.246
NP_441602.1_3 Reverse -99 -118 -2.26216 0.233
NP_441602.1_3 Forward -118 -99 -3.14714 0.241
NP_441602.1_3 Reverse -176 -195 -3.44213 0.246
NP_441972.1_5 Reverse -246 -265 -5.9004 0.226
NP_441106.1_1 Forward -114 -105 18.486 0.0028
NP_441106.1_1 Reverse -103 -112 18.191 0.0028
NP_441106.1_1 Reverse -274 -283 7.76787 0.0764
NP_441106.1_1 Forward -225 -216 4.42462 0.226
NP_439903.1_6 Forward -116 -97 13.8633 0.0781
NP_439903.1_6 Reverse -101 -120 8.4551 0.136
NP_441286.1_1 Reverse -103 -115 5.15219 0.0259
NP_441286.1_1 Forward -114 -102 5.05386 0.0259
NP_441286.1_1 Forward -285 -273 -4.58258 0.165
NP_441286.1_1 Forward -315 -303 -5.17256 0.192
NP_442674.1_1 Forward -227 -208 10.3673 0.282
NP_442674.1_3 Forward -121 -102 8.75009 0.193
NP_440670.1_8 Forward -113 -104 18.3876 0.000699
NP_440670.1_8 Reverse -104 -113 18.3876 0.000699
NP_440886.1_7 Reverse -103 -113 17.7774 0.0011
NP_440886.1_7 Forward -114 -104 8.04271 0.0805
NP_440886.1_7 Forward -26 -16 6.66608 0.115
NP_442072.1_9 Reverse -103 -121 -3.52077 0.0363
NP_442072.1_9 Forward -114 -96 -15.2222 0.174
NP_442072.1_9 Forward -285 -267 -22.892 0.266
NP_442072.1_9 Forward -173 -155 -23.3836 0.292
NP_440513.1_6 Reverse -235 -254 11.3067 0.222
NP_442800.1_7 Reverse -337 -356 6.39097 0.219
NP_440907.2_8 Reverse -105 -115 19.1541 0.00362
NP_440907.2_8 Forward -112 -102 7.84605 0.117
NP_442264.1_2 Reverse -94 -111 6.62702 0.251
NP_442264.1_5 Reverse -181 -195 11.406 0.26
NP_441463.1_3 Reverse -94 -113 -7.76869 0.261
NP_442893.1_4 Reverse -311 -330 -2.36125 0.281
NP_441626.1_2 Forward -112 -105 15.7721 0.0124
NP_441626.1_2 Reverse -105 -112 15.7721 0.0124
NP_441626.1_2 Forward -283 -276 14.2971 0.0271
NP_441626.1_2 Reverse -276 -283 5.93897 0.231
NP_442211.1_7 Reverse -193 -212 8.94676 0.295
NP_442365.1_7 Reverse -100 -119 -6.1954 0.286
NP_442794.1_1 Forward -288 -276 10.4621 0.0721
NP_442794.1_1 Reverse -100 -112 10.1671 0.0721
NP_442615.1_1 Forward -122 -104 6.01734 0.0368
NP_442615.1_1 Forward -293 -275 -6.37237 0.244
NP_442615.1_1 Forward -34 -16 -6.96235 0.271
NP_442615.1_1 Reverse -266 -284 -7.15901 0.278
NP_442615.1_1 Forward -233 -215 -7.15901 0.278
NP_441962.1_4 Forward -118 -99 9.14423 0.0606
NP_441962.1_4 Forward -195 -176 -6.68705 0.18
NP_441962.1_4 Reverse -105 -124 -12.3902 0.256
NP_440387.1_1 Forward -113 -97 13.3332 0.00865
NP_440387.1_1 Reverse -104 -120 9.10498 0.0282
NP_440387.1_1 Forward -37 -21 -6.23465 0.273
NP_440855.1_5 Reverse -102 -121 8.4551 0.285
NP_441431.1_2 Reverse -101 -115 8.3571 0.218
NP_441431.1_2 Forward -116 -102 5.60385 0.294
NP_441431.1_3 Reverse -251 -270 2.55606 0.283
NP_441836.1_2 Reverse -209 -228 -2.36049 0.229
NP_441993.1_1 Forward -119 -100 13.0568 0.0897
NP_441993.1_1 Reverse -104 -123 11.9848 0.106
NP_441174.1_2 Reverse -101 -115 14.0609 0.176
NP_440114.1_10 Reverse -104 -118 12.0943 0.0924
NP_440114.1_10 Forward -284 -270 5.89945 0.292
NP_442323.1_7 Reverse -99 -118 6.88182 0.19
NP_441510.2_6 Reverse -94 -113 13.2733 0.257
NP_441510.2_7 Reverse -98 -112 12.2903 0.28
NP_441272.1_4 Forward -122 -103 2.55606 0.233
NP_440766.1_4 Forward -117 -103 16.7159 0.0256
NP_440766.1_4 Reverse -100 -114 8.16106 0.0871
NP_441421.1_6 Forward -332 -315 10.5563 0.279
NP_441133.1_3 Forward -122 -103 14.8474 0.272
NP_439910.1_2 Reverse -267 -284 15.4768 0.0042
NP_439910.1_2 Reverse -96 -113 -13.4325 0.162
NP_440457.1_1 Reverse -100 -112 8.29878 0.101
NP_440457.1_1 Forward -117 -105 5.44718 0.141
NP_441801.1_4 Forward -201 -191 3.12662 0.231
NP_441801.1_4 Forward -48 -38 3.02829 0.231
NP_440142.1_9 Reverse -135 -149 20.9434 0.076
NP_441984.1_1 Forward -119 -101 12.5072 0.19
NP_442509.1_5 Forward -87 -70 16.951 0.164
NP_442509.1_9 Forward -113 -103 16.2041 0.00739
NP_442509.1_9 Reverse -104 -114 8.04271 0.192
NP_442514.1_5 Forward -366 -347 -8.45774 0.285
NP_442514.1_6 Forward -123 -104 5.40766 0.24
NP_440554.1_4 Reverse -105 -115 15.418 0.0199
NP_440554.1_4 Forward -112 -102 14.6313 0.02
NP_440554.1_4 Forward -283 -273 8.4365 0.0749
NP_440554.1_4 Reverse -216 -226 3.91327 0.211
NP_441845.1_6 Reverse -350 -368 4.34571 0.211
NP_441761.1_1 Reverse -182 -201 2.0644 0.285
NP_441885.1_5 Forward -113 -103 11.4848 0.00668
NP_441885.1_5 Reverse -104 -114 11.3864 0.00668
NP_441885.1_5 Reverse -275 -285 9.91146 0.0172
NP_441885.1_5 Forward -284 -274 0.373358 0.164
NP_440478.1_10 Forward -45 -31 6.48943 0.291
NP_442341.1_7 Reverse -103 -117 12.7826 0.0415
NP_442341.1_7 Forward -206 -192 11.996 0.049
NP_442341.1_7 Forward -114 -100 9.34103 0.0751
NP_441756.1_5 Reverse -100 -119 4.62101 0.199
NP_441756.1_5 Forward -41 -22 -0.0988766 0.242
NP_442395.2_4 Forward -185 -166 8.65176 0.122
NP_442395.2_4 Reverse -103 -122 6.48849 0.146
NP_440423.1_6 Forward -121 -102 -13.3736 0.217
NP_443000.1_7 Forward -115 -105 10.7964 0.0345
NP_443000.1_7 Forward -286 -276 10.2065 0.0355
NP_443000.1_7 Reverse -102 -112 8.73149 0.0437
NP_443000.1_7 Reverse -273 -283 6.96153 0.109
NP_440507.2_3 Forward -122 -103 8.35677 0.253
NP_441842.1_10 Forward -120 -106 11.996 0.113
NP_441842.1_10 Reverse -189 -203 6.58777 0.283
NP_440275.1_3 Forward -115 -105 18.6629 0.0082
NP_440275.1_3 Reverse -102 -112 8.4365 0.0602
NP_440275.1_3 Forward -286 -276 5.38824 0.153
NP_440091.1_1 Forward -117 -105 3.2839 0.163
NP_440091.1_1 Reverse -271 -283 1.41561 0.197
NP_440091.1_1 Reverse -100 -112 1.41561 0.197
NP_441359.1_5 Reverse -101 -120 23.2056 0.0155
NP_442451.1_2 Reverse -96 -115 -6.88371 0.232
NP_440149.1_8 Forward -113 -94 5.50599 0.0746
NP_441105.1_3 Forward -124 -105 23.9922 0.00252
NP_441105.1_3 Forward -295 -276 -9.34199 0.288
NP_440216.1_1 Forward -25 -11 -1.5737 0.034
NP_440216.1_1 Reverse -104 -118 -1.8687 0.0412
NP_440216.1_1 Forward -113 -99 -2.26202 0.0484
NP_440678.1_9 Forward -118 -99 8.25926 0.279
NP_440172.1_1 Reverse -104 -114 17.5813 0.00421
NP_440172.1_1 Forward -284 -274 10.5014 0.049
NP_440172.1_1 Forward -113 -103 8.73149 0.0586
NP_440172.1_6 Forward -125 -106 8.55425 0.259
NP_442015.1_10 Reverse -100 -113 19.1938 0.00444
NP_442015.1_10 Forward -288 -275 1.78924 0.204
NP_442015.1_10 Reverse -281 -294 0.117615 0.241
NP_441045.1_4 Reverse -223 -242 11.9958 0.274
NP_441226.1_7 Forward -112 -105 14.4934 0.0123
NP_441226.1_7 Reverse -105 -112 14.4934 0.0123
NP_441226.1_7 Reverse -276 -283 5.54531 0.289
NP_441111.1_7 Forward -112 -104 18.7023 0.00294
NP_441111.1_7 Reverse -105 -113 18.7023 0.00294
NP_441111.1_7 Reverse -276 -284 8.86921 0.0589
NP_442379.1_10 Forward -120 -103 -1.63279 0.223
NP_441766.1_2 Forward -113 -104 17.5026 0.00297
NP_441766.1_2 Reverse -104 -113 17.5026 0.00297
NP_441766.1_2 Forward -284 -275 8.1612 0.0645
NP_442969.1_4 Reverse -222 -241 5.211 0.274
NP_442417.1_5 Forward -113 -99 21.3374 0.00922
NP_440416.1_9 Forward -120 -101 -15.0452 0.184
NP_440416.1_9 Forward -231 -212 -21.7317 0.296
NP_443052.1_8 Reverse -265 -284 -5.40875 0.13
NP_442552.1_1 Reverse -131 -150 6.29264 0.203
NP_440591.1_9 Forward -120 -102 7.59063 0.198
NP_442154.1_1 Reverse -63 -81 -16.7954 0.245
NP_440261.1_5 Reverse -276 -289 -4.89726 0.178
NP_440261.1_5 Forward -223 -210 -8.33885 0.201
NP_440261.1_5 Forward -112 -99 -10.5021 0.201
NP_440261.1_5 Reverse -105 -118 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCTGGCCCATTACCGCTTCTTTGAGTTGTTAGACCCCGTTTAACCAGCCGAAATCATCGAGAACAGTTAAAAATAGCTTAAAAATGGCTATCTACCTCAAACTTCGGTAATCCCTGGCGATAGCTTTTTAATTCCCCACTCCGGGGGCCATAAACTCCTTCAATCTGTTCTTCACAGCAATGGCTAGCAAATTCGTCGAACTCCGCCGGAGCAATGCCAAACATCCGGGCAAAGTTATCTGGTTTCACCCGGCAAAAACTGGGCCTATCTTCGTAAATCTGGCAGAGGCGATCGCCGTGGTTGTAATTAACGCACCAACCGTCTGCCCCCACTAGGCTGTGGTAGAGGGTTAACTCCTCCGGGGCGAGATACTCGGCCAACTCCGGCCGGTCTTCTGGG

CDS

GTGAGATTACAACAAGCGCCACATCCCTGCATGCAATACCAAGTTGCCATGGCCGGTCTCCTTCTTCACATAACTTTATGTATTTTTATGACGGCAAGTCCAGGGGACGAAACCAACCCAGCTATTATAGACATTGGTTTTATTATCCTTGCTTACGTTGAGTCTAGCCAGCAGTTTTTAACAGGAGAAATTATGGAATTATTAGCCGCACTCAATTTAGAACCTATTTTTCAGTTGACTTTTTTGGGCCTGATTGTTCTTGCTGGGCCGGCGGTGGTGTTTGTGCTAGCCTTCCGAGGCGGCGATCTATAG

Protein

MRLQQAPHPCMQYQVAMAGLLLHITLCIFMTASPGDETNPAIIDIGFIILAYVESSQQFLTGEIMELLAALNLEPIFQLTFLGLIVLAGPAVVFVLAFRGGDL