Your browser is old and dusty. Try Google Chrome!

Details for sll0017

ORF sll0017
Accession NP_442115.2
Symbol hemL
Category Cobalamin, heme, phycobilin and porphyrin
Definition glutamate-1-semialdehyde aminomutase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -281 -288 13.6088 0.0364
NP_441418.1_6 Reverse -280 -299 -29.0082 0.215
NP_441453.1_4 Forward -289 -281 7.09925 0.0962
NP_442838.1_7 Reverse -69 -88 -4.72043 0.232
NP_441818.1_9 Reverse -294 -313 -8.35868 0.277
NP_440226.1_1 Forward -289 -270 2.16274 0.276
NP_442173.1_1 Reverse -281 -289 14.1791 0.0165
NP_442173.1_1 Forward -288 -280 4.64098 0.26
NP_443027.1_4 Forward -291 -281 8.1415 0.218
NP_442975.1_10 Forward -293 -279 7.17714 0.142
NP_440784.1_7 Forward -288 -281 6.62729 0.168
NP_440784.1_7 Reverse -281 -288 6.52896 0.176
NP_440110.1_8 Reverse -278 -297 -2.0655 0.258
NP_441054.1_2 Reverse -147 -166 9.3409 0.299
NP_442062.1_8 Forward -289 -279 4.69992 0.201
NP_440304.1_4 Forward -291 -281 7.25653 0.125
NP_440916.1_1 Forward -355 -341 12.0943 0.206
NP_442602.1_3 Reverse -253 -272 -2.16383 0.255
NP_441200.1_4 Forward -246 -227 6.68596 0.272
NP_441200.1_6 Forward -298 -281 10.0686 0.285
NP_441925.1_4 Forward -315 -296 -17.4058 0.294
NP_440769.1_8 Forward -335 -316 10.2259 0.188
NP_441149.1_9 Forward -321 -302 -2.16459 0.291
NP_441738.1_2 Reverse -384 -391 8.1019 0.204
NP_441645.1_6 Reverse -232 -246 15.4369 0.193
NP_441792.1_1 Reverse -225 -244 5.89931 0.253
NP_441327.1_5 Reverse -378 -387 16.6177 0.111
NP_440906.1_5 Reverse -281 -288 6.43063 0.223
NP_440906.1_5 Forward -288 -281 6.3323 0.234
NP_442848.1_1 Forward -91 -77 -2.55701 0.263
NP_443018.1_3 Reverse -281 -288 5.44732 0.193
NP_443018.1_3 Forward -288 -281 5.34899 0.212
NP_440376.1_1 Forward -273 -264 1.47469 0.251
NP_441077.1_6 Forward -365 -349 9.93598 0.164
NP_441846.1_10 Forward -241 -222 -22.9117 0.271
NP_441846.1_10 Forward -248 -229 -23.1083 0.277
NP_440642.1_10 Forward -385 -371 3.24392 0.277
NP_441950.1_7 Forward -245 -226 -0.590531 0.191
NP_442782.1_2 Reverse -153 -167 8.84938 0.198
NP_442205.1_9 Reverse -251 -267 -3.18639 0.28
NP_441414.1_9 Forward -289 -270 -10.9153 0.297
NP_441137.1_2 Forward -68 -54 16.8168 0.258
NP_440373.1_2 Forward -369 -350 16.2843 0.152
NP_439990.1_5 Reverse -148 -161 5.82081 0.272
NP_440138.1_1 Reverse -46 -64 17.6196 0.0797
NP_442002.1_1 Reverse -298 -316 -10.5023 0.294
NP_442002.1_9 Reverse -164 -171 11.3472 0.185
NP_441712.1_1 Forward -366 -347 10.1007 0.282
NP_441292.1_2 Reverse -146 -165 -5.99873 0.241
NP_441000.1_5 Forward -313 -294 14.4533 0.119
NP_441000.1_5 Forward -268 -249 6.29183 0.248
NP_440206.1_4 Reverse -225 -244 -1.8696 0.293
NP_440345.1_3 Forward -260 -246 10.8977 0.267
NP_441041.1_4 Forward -241 -222 -10.9153 0.238
NP_442396.1_5 Reverse -97 -110 10.5407 0.109
NP_441725.1_5 Forward -288 -278 0.471689 0.173
NP_442941.1_3 Reverse -281 -291 7.94484 0.0486
NP_442941.1_3 Forward -288 -278 0.963343 0.16
NP_442215.1_2 Forward -203 -187 -0.531451 0.168
NP_442029.1_6 Forward -247 -228 5.99764 0.246
NP_442554.1_8 Forward -288 -278 3.02829 0.245
NP_442292.1_1 Forward -288 -279 8.35786 0.0411
NP_441523.1_6 Forward -166 -147 3.93269 0.261
NP_442301.1_5 Forward -252 -233 21.6314 0.0511
NP_441468.1_1 Reverse -281 -288 6.52896 0.135
NP_441468.1_1 Forward -288 -281 6.3323 0.202
NP_441876.1_9 Forward -81 -71 14.0409 0.267
NP_441764.1_8 Forward -367 -357 10.8322 0.297
NP_442227.1_2 Reverse -225 -244 -1.37718 0.262
NP_442692.1_4 Forward -175 -156 13.3725 0.249
NP_440145.1_3 Reverse -18 -37 -1.18052 0.148
NP_442050.1_5 Forward -291 -281 7.74772 0.243
NP_442050.1_5 Reverse -278 -288 6.56775 0.294
NP_442789.1_4 Reverse -278 -297 -8.26035 0.299
NP_441036.1_3 Reverse -250 -269 0.0977854 0.181
NP_441557.1_5 Reverse -280 -289 6.68623 0.0508
NP_441445.1_1 Forward -282 -263 3.24438 0.218
NP_441590.1_4 Reverse -221 -240 5.99684 0.26
NP_440084.1_8 Reverse -349 -363 17.9641 0.161
NP_441739.1_2 Forward -175 -159 5.17106 0.228
NP_441116.1_9 Reverse -296 -310 11.2093 0.291
NP_440861.1_2 Reverse -19 -38 15.2223 0.169
NP_440136.1_2 Reverse -281 -288 6.52896 0.116
NP_440136.1_2 Forward -288 -281 6.43063 0.154
NP_442998.1_5 Reverse -379 -389 13.7464 0.157
NP_442998.1_5 Reverse -378 -388 9.91146 0.232
NP_440899.1_8 Reverse -351 -370 -5.31042 0.231
NP_440299.1_1 Reverse -276 -289 8.18017 0.0964
NP_440640.1_6 Reverse -297 -316 0.58944 0.271
NP_440256.1_1 Reverse -277 -296 -5.99873 0.198
NP_442158.1_4 Forward -64 -54 11.8781 0.264
NP_441464.1_1 Forward -297 -278 8.16093 0.261
NP_441464.1_10 Forward -66 -52 9.04604 0.265
NP_440695.1_6 Forward -356 -342 9.24786 0.292
NP_441939.1_3 Forward -84 -65 7.7676 0.19
NP_442993.1_1 Forward -395 -379 -9.5779 0.188
NP_440677.1_6 Reverse -336 -355 13.1758 0.185
NP_442386.1_10 Forward -240 -227 4.14919 0.265
NP_441340.1_5 Reverse -281 -288 6.23397 0.132
NP_441340.1_5 Forward -288 -281 6.13563 0.175
NP_441340.1_9 Reverse -313 -323 7.38756 0.27
NP_440327.1_6 Reverse -294 -313 10.2259 0.193
NP_441262.1_3 Reverse -280 -287 5.44732 0.11
NP_443051.1_1 Forward -290 -281 0.688044 0.134
NP_443051.1_1 Reverse -279 -288 -1.08191 0.281
NP_441232.1_10 Reverse -269 -288 13.0775 0.0698
NP_439937.1_9 Reverse -228 -245 -10.3849 0.227
NP_439937.1_9 Forward -264 -247 -12.9415 0.278
NP_441595.1_2 Reverse -108 -121 11.3298 0.277
NP_440439.1_1 Reverse -71 -84 1.29759 0.157
NP_439943.1_7 Reverse -29 -48 10.1275 0.168
NP_440372.1_2 Reverse -281 -288 6.92228 0.0492
NP_440372.1_2 Forward -288 -281 6.82395 0.0854
NP_440171.1_3 Forward -243 -224 5.89931 0.28
NP_442783.1_8 Forward -160 -141 15.7316 0.23
NP_440819.1_5 Reverse -370 -378 7.8859 0.266
NP_440819.1_5 Reverse -378 -386 7.68924 0.266
NP_441689.1_5 Forward -291 -281 10.5993 0.132
NP_440531.1_6 Forward -215 -196 -2.16383 0.246
NP_440531.1_8 Forward -231 -212 2.45773 0.298
NP_440297.1_9 Forward -288 -278 0.176696 0.282
NP_441592.1_4 Reverse -226 -245 -3.44213 0.281
NP_440999.1_9 Reverse -228 -242 -0.197071 0.201
NP_440600.1_4 Forward -297 -279 1.29745 0.128
NP_440600.1_4 Reverse -272 -290 -0.669169 0.155
NP_441543.1_3 Reverse -228 -242 12.6836 0.163
NP_440380.1_1 Forward -249 -230 -10.522 0.284
NP_441469.1_8 Reverse -279 -288 5.11294 0.289
NP_441469.1_8 Reverse -208 -217 5.01461 0.297
NP_442315.1_2 Reverse -246 -258 12.822 0.291
NP_443064.1_3 Reverse -237 -256 10.5209 0.177
NP_443064.1_3 Forward -254 -235 8.75091 0.19
NP_442578.1_5 Reverse -228 -247 19.3707 0.0816
NP_442578.1_7 Reverse -281 -288 11.9372 0.0739
NP_440710.1_1 Forward -297 -279 -2.53746 0.194
NP_440071.1_6 Forward -243 -229 13.611 0.261
NP_441462.1_2 Reverse -280 -290 -0.0199663 0.177
NP_441621.1_4 Forward -303 -290 14.9656 0.246
NP_441560.1_10 Forward -281 -262 8.94757 0.235
NP_442428.1_5 Reverse -281 -288 6.43063 0.148
NP_442428.1_5 Forward -288 -281 6.3323 0.193
NP_440673.1_3 Reverse -282 -289 11.2488 0.0938
NP_440673.1_7 Forward -300 -281 7.07928 0.149
NP_441719.1_4 Reverse -281 -288 6.92228 0.0565
NP_441719.1_4 Forward -288 -281 6.82395 0.0855
NP_440746.1_3 Reverse -36 -55 8.45592 0.239
NP_442813.1_2 Forward -330 -311 -2.26216 0.273
NP_442813.1_4 Reverse -278 -297 -8.35868 0.299
NP_442813.1_4 Reverse -235 -254 -8.752 0.299
NP_441851.1_10 Reverse -279 -289 5.97822 0.19
NP_441668.1_4 Reverse -296 -315 -1.67217 0.278
NP_441396.1_5 Forward -63 -54 8.35786 0.224
NP_442709.1_3 Forward -248 -229 6.39097 0.156
NP_440432.1_9 Reverse -281 -296 -3.95334 0.194
NP_442843.1_1 Reverse -290 -309 -2.16383 0.203
NP_440474.1_8 Forward -288 -274 5.21053 0.254
NP_442006.1_2 Forward -238 -221 -16.1858 0.243
NP_441570.1_1 Forward -289 -271 2.28076 0.0252
NP_441570.1_1 Reverse -280 -298 -15.7138 0.233
NP_442443.1_1 Forward -288 -269 -4.22878 0.268
NP_442443.1_1 Forward -215 -196 -5.60541 0.282
NP_440793.1_1 Forward -385 -371 10.422 0.291
NP_441432.1_8 Reverse -27 -36 10.0295 0.0681
NP_443024.1_2 Reverse -229 -242 17.2266 0.167
NP_442320.1_8 Forward -295 -281 -5.80194 0.249
NP_441945.1_10 Reverse -279 -298 6.58763 0.299
NP_440713.1_4 Reverse -270 -289 2.45773 0.262
NP_440941.1_1 Reverse -156 -166 15.8113 0.277
NP_440559.1_1 Forward -288 -279 6.98123 0.117
NP_441659.2_8 Forward -289 -279 9.61647 0.0284
NP_442749.1_5 Reverse -157 -174 12.7548 0.159
NP_442346.1_5 Forward -290 -280 9.02648 0.118
NP_440025.1_3 Reverse -161 -175 10.6108 0.29
NP_440486.1_6 Reverse -332 -351 8.35759 0.245
NP_442900.1_2 Reverse -170 -189 2.0644 0.289
NP_441233.1_9 Forward -293 -274 19.6656 0.117
NP_441888.1_7 Forward -396 -382 0.786239 0.281
NP_441833.1_4 Reverse -281 -288 6.52896 0.0924
NP_441833.1_4 Forward -288 -281 6.43063 0.125
NP_441329.1_6 Reverse -65 -84 -2.0535 0.293
NP_442060.1_5 Reverse -152 -171 11.7992 0.29
NP_442162.1_9 Reverse -281 -288 6.82395 0.0927
NP_442162.1_9 Forward -288 -281 6.72562 0.116
NP_440224.1_1 Forward -344 -325 -2.85214 0.241
NP_442723.1_1 Forward -323 -304 12.0933 0.238
NP_441813.1_5 Reverse -278 -288 5.68323 0.113
NP_441813.1_5 Forward -291 -281 5.5849 0.118
NP_440567.1_1 Reverse -281 -295 0.982901 0.224
NP_442497.1_10 Reverse -281 -290 6.29291 0.0771
NP_442497.1_10 Forward -288 -279 -0.983583 0.224
NP_440821.1_4 Reverse -278 -288 8.23984 0.053
NP_441239.1_9 Reverse -227 -239 7.4138 0.161
NP_441951.1_9 Forward -313 -294 1.96607 0.254
NP_440156.1_4 Forward -355 -345 13.2542 0.176
NP_441727.1_3 Reverse -40 -59 3.6377 0.284
NP_440400.1_1 Forward -315 -296 11.7 0.2
NP_440400.1_1 Reverse -55 -74 -3.14789 0.291
NP_441892.1_1 Forward -298 -281 0.0388413 0.176
NP_440665.1_1 Reverse -235 -254 -14.5535 0.262
NP_442669.1_1 Forward -339 -320 26.6471 0.0000881
NP_442643.1_1 Reverse -274 -293 -11.1119 0.231
NP_440833.1_6 Reverse -315 -329 8.84875 0.272
NP_440833.1_6 Forward -176 -162 8.75042 0.272
NP_440462.1_6 Forward -291 -281 6.66654 0.105
NP_441474.1_1 Forward -312 -293 -3.04956 0.29
NP_442402.1_10 Forward -259 -249 13.6475 0.2
NP_442402.1_10 Forward -258 -248 13.5492 0.2
NP_442402.1_10 Forward -352 -342 10.3043 0.297
NP_442039.1_7 Reverse -132 -142 8.33817 0.263
NP_442039.1_10 Forward -313 -295 17.0296 0.209
NP_442837.1_3 Reverse -281 -288 6.43063 0.212
NP_442837.1_3 Forward -288 -281 6.23397 0.244
NP_439994.1_4 Reverse -190 -209 9.53756 0.28
NP_440351.1_1 Reverse -233 -252 6.39097 0.067
NP_441536.1_6 Forward -172 -153 23.2419 0.0219
NP_441252.1_6 Reverse -162 -169 14.3954 0.168
NP_441203.1_1 Reverse -281 -300 -17.4051 0.293
NP_441011.1_8 Reverse -281 -290 8.45619 0.144
NP_442533.1_1 Forward -248 -229 -8.26035 0.202
NP_442533.1_6 Reverse -280 -289 2.65466 0.246
NP_442533.1_6 Reverse -198 -207 2.65466 0.246
NP_441482.1_7 Forward -295 -281 -5.40861 0.182
NP_439944.1_9 Forward -288 -278 7.25653 0.149
NP_439944.1_9 Reverse -281 -291 6.76487 0.168
NP_441028.1_6 Forward -386 -376 12.0743 0.192
NP_441028.1_6 Reverse -180 -190 5.48612 0.255
NP_441028.1_6 Reverse -266 -276 3.8145 0.281
NP_441028.1_6 Forward -82 -72 3.8145 0.281
NP_441527.1_4 Reverse -373 -392 -10.0748 0.264
NP_440007.1_9 Reverse -24 -38 4.12949 0.267
NP_441106.1_1 Forward -290 -281 14.8477 0.0192
NP_441286.1_1 Forward -86 -74 -4.87757 0.18
NP_441286.1_1 Reverse -279 -291 -5.56589 0.208
NP_440886.1_10 Forward -383 -364 11.995 0.154
NP_442614.1_2 Reverse -198 -212 8.75105 0.248
NP_441463.1_3 Reverse -270 -289 5.211 0.0771
NP_441626.1_2 Forward -288 -281 12.6255 0.0468
NP_441626.1_2 Reverse -281 -288 6.3323 0.155
NP_442365.1_7 Forward -293 -274 -3.83545 0.225
NP_440387.1_1 Reverse -280 -296 -4.95634 0.208
NP_441510.2_2 Reverse -225 -244 7.66846 0.213
NP_442743.1_1 Forward -165 -146 11.2084 0.241
NP_440457.1_1 Reverse -276 -288 4.46387 0.161
NP_440457.1_1 Reverse -24 -36 -1.23932 0.3
NP_440942.1_3 Reverse -148 -167 15.0441 0.106
NP_440942.1_6 Reverse -227 -246 12.4867 0.257
NP_440554.1_4 Reverse -281 -291 8.73149 0.0668
NP_441885.1_5 Reverse -28 -38 -1.49493 0.264
NP_441173.1_9 Forward -257 -249 11.3271 0.226
NP_441173.1_9 Forward -256 -248 11.3271 0.226
NP_442395.2_4 Forward -307 -288 -0.39464 0.291
NP_443000.1_7 Forward -291 -281 7.25653 0.0927
NP_441842.1_10 Forward -296 -282 7.07942 0.267
NP_440560.1_5 Forward -259 -240 18.3915 0.0646
NP_440091.1_1 Reverse -276 -288 -0.74767 0.286
NP_439962.1_4 Forward -314 -295 -5.50708 0.28
NP_442371.1_1 Reverse -377 -387 14.0409 0.191
NP_441226.1_7 Reverse -281 -288 11.8385 0.0485
NP_441111.1_7 Forward -288 -280 -0.570565 0.233
NP_441111.1_7 Reverse -281 -289 -0.570565 0.233
NP_441766.1_2 Reverse -280 -289 13.3727 0.0128
NP_442417.1_5 Reverse -280 -294 8.25939 0.164
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCTACGCTAGCGATTTTTCCCTGTTTCCCGGTACAGAAAATCTGAAAATTTCCCCGCGCCTCAGAACGTGTTTGGAAAGTTTTACTCCGCCCCCCAAATTGACCCACTAAAGCGACCGCAATACTGGGGGACTGTCACTCAGTTTCCCCCAAAATCTGGGGGGTCAGGGGGGCGTTTAAAACGGGCTCTCAGAGTCTTGGCCCAAACAAATGGAGGTTAACAGCTATAAATTGCCCAAACTCTCACCAAGGACTCTAGGTTCCCAGCTAGTGTGTCAGAAGTTTGTTCAATGGAGCACCAAAATTCTGTAGAGTGGAGTTCTCCCCGTCTGTTTTTTTGATGTGGGCACAGGTTCAATAAATTCCCATAGCCAGTCTTTACACCCTAAGGAGACGCGAA

CDS

TTGGTTAACGCAACCCCTTTTATTACCACTAAATCAGAAGAGATTTTTGCCGCCGCTCAACATTTAATGCCCGGTGGTGTCAGTTCCCCGGTAAGAGCTTTCAAGTCCGTCGGCGGCCAGCCCATTGTTTTTGACCGAGTAGAAGGGGCTCAGATTTGGGACGTAGATGGTAATCAATACATTGACTATGTGGGTACCTGGGGGCCGGCCATTTGTGGCCACGCTCACCCCGATGTAATCAGCGCCCTCAAACAAGCTTTGGATAAAGGCACCAGTTTTGGTGCTCCCTGTGCCCAGGAAAACGTACTGGCGGAAATGGTCATTGATGCTGTGCCTAGCATTGAAATGGTACGGTTTGTCAACTCCGGTACCGAAGCCTGTATGTCCGTTTTGCGCTTGATGCGGGCCTTCACTGGACGGGAAAAAATCATTAAATTTGAGGGTTGTTACCACGGCCACGCCGATATGTTCTTGGTCAAAGCTGGTTCTGGGGTGGCGACCCTCGGTTTACCGGATTCCCCTGGGGTGCCCAGTAACACAACTAAAGCAACATTGACTGCTCCTTATAACGATCTAGAGGCGGTTAAAGCTCTGTTCGTGGAAAATCCTGACAGCATTGCCGGGGTAATTCTCGAGCCAGTGGTGGGTAATGCCGGTTTTATCCTCCCCGATGCGGGCTTTTTGGAAGGTTTACGGGAACTGACCAAGGAGTATGGTGCTCTGTTGGTTTTTGATGAGGTGATGACAGGTTTTCGGGTTTCCTACGGTGGTGCCCAAGCCCGGTTTGGCATTACTCCCGATTTGACTACCCTCGGTAAGGTGATCGGTGGTGGTTTACCAGTAGGAGCCTATGGTGGTCGGGAAGAAATTATGGCCATGGTGGCTCCAGCCGGCCCCATGTATCAAGCGGGTACCCTGTCCGGCAACCCGTTGGCCATGACGGCGGGTATTAAAACCCTGGAAATTCTGCAAAAGCCAGGATCCTACGAATATTTGGATAAGATCACCAAACGGCTAGTGGATGGTTTACTAGCTGCGGCTCAGGATGCGGGCCATGAAGTTTGTGGCGGTTCCATCAGTGCCATGTTTGGAATTTTCTTTGCTCCTGGCCCTGTCAGAAACTATGAAGATGCTAAGTTGGCCGACACCAATAAATTTGCCCGTTTCCATCGGGGTATGTTGGAAAGGGGGATTTATCTAGCTCCTTCCCAGTATGAAGCGGGTTTTCCTTCCCTAGCCCACACCCAAGAACAGATCGATCAGACCATTGCCGTCGCTAAGGAAGTATTTGCTACTCTCTGA

Protein

MVNATPFITTKSEEIFAAAQHLMPGGVSSPVRAFKSVGGQPIVFDRVEGAQIWDVDGNQYIDYVGTWGPAICGHAHPDVISALKQALDKGTSFGAPCAQENVLAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPSNTTKATLTAPYNDLEAVKALFVENPDSIAGVILEPVVGNAGFILPDAGFLEGLRELTKEYGALLVFDEVMTGFRVSYGGAQARFGITPDLTTLGKVIGGGLPVGAYGGREEIMAMVAPAGPMYQAGTLSGNPLAMTAGIKTLEILQKPGSYEYLDKITKRLVDGLLAAAQDAGHEVCGGSISAMFGIFFAPGPVRNYEDAKLADTNKFARFHRGMLERGIYLAPSQYEAGFPSLAHTQEQIDQTIAVAKEVFATL