Your browser is old and dusty. Try Google Chrome!

Details for sll0007

ORF sll0007
Accession NP_442134.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -111 -97 15.4376 0.104
NP_441061.1_2 Reverse -103 -117 13.8643 0.0392
NP_441061.1_2 Reverse -154 -168 -1.8687 0.274
NP_441061.1_3 Forward -226 -207 22.6147 0.024
NP_440795.1_7 Forward -110 -103 14.6904 0.0123
NP_440795.1_7 Reverse -103 -110 14.6904 0.0123
NP_441418.1_6 Reverse -102 -121 -22.2233 0.172
NP_441418.1_6 Forward -111 -92 -28.2215 0.203
NP_441418.1_6 Reverse -160 -179 -28.8115 0.211
NP_442291.1_5 Reverse -101 -117 6.74504 0.0689
NP_440897.1_6 Forward -111 -92 0.883656 0.175
NP_440897.1_6 Reverse -102 -121 -0.197979 0.182
NP_441453.1_4 Reverse -102 -110 16.539 0.00633
NP_441453.1_4 Forward -111 -103 16.539 0.00633
NP_441453.1_4 Forward -117 -109 5.42762 0.135
NP_441960.1_3 Reverse -253 -272 16.3746 0.162
NP_442151.1_6 Reverse -102 -116 18.7808 0.00618
NP_442151.1_6 Forward -181 -167 13.3726 0.0528
NP_442151.1_6 Forward -111 -97 10.4227 0.123
NP_442151.1_6 Reverse -108 -122 9.73436 0.141
NP_442151.1_6 Forward -47 -33 7.76774 0.19
NP_441818.1_1 Reverse -103 -114 18.446 0.0046
NP_441818.1_1 Forward -46 -35 12.6445 0.114
NP_442623.1_3 Forward -110 -91 -0.590531 0.0786
NP_442173.1_1 Forward -110 -102 15.4574 0.00633
NP_442173.1_1 Reverse -103 -111 15.4574 0.00633
NP_442752.1_4 Forward -111 -104 13.8055 0.0199
NP_442752.1_4 Reverse -102 -109 13.8055 0.0199
NP_443027.1_4 Forward -113 -103 14.0414 0.0452
NP_443027.1_4 Reverse -100 -110 13.2547 0.0521
NP_442975.1_10 Forward -115 -101 12.782 0.0459
NP_442975.1_10 Reverse -98 -112 4.22722 0.245
NP_440784.1_7 Forward -110 -103 15.9687 0.0123
NP_440784.1_7 Reverse -103 -110 15.9687 0.0123
NP_440784.1_7 Reverse -173 -180 5.84064 0.248
NP_442909.1_7 Reverse -103 -117 13.8636 0.12
NP_442909.1_7 Forward -116 -102 9.83206 0.14
NP_440061.1_6 Forward -134 -116 12.2114 0.261
NP_440061.1_9 Reverse -100 -114 12.6836 0.0927
NP_440061.1_9 Forward -113 -99 11.1104 0.117
NP_440061.1_9 Reverse -3 -17 5.60385 0.279
NP_442062.1_8 Reverse -102 -112 17.3846 0.00193
NP_442062.1_8 Forward -111 -101 10.3048 0.0493
NP_441859.1_3 Reverse -37 -56 3.53858 0.239
NP_440304.1_4 Forward -113 -103 10.8948 0.051
NP_440304.1_4 Reverse -100 -110 10.8948 0.051
NP_442242.1_4 Forward -110 -103 14.3954 0.0124
NP_442242.1_4 Reverse -103 -110 14.3954 0.0124
NP_442242.1_4 Forward -46 -39 9.47889 0.251
NP_440044.1_8 Forward -180 -161 0.58944 0.195
NP_441581.1_6 Reverse -163 -182 10.456 0.284
NP_440011.1_1 Forward -113 -94 18.0924 0.153
NP_439918.1_2 Forward -168 -149 -4.22878 0.272
NP_441208.1_9 Forward -114 -100 7.37441 0.222
NP_442276.1_1 Forward -394 -375 14.0599 0.238
NP_440518.1_8 Reverse -74 -93 14.0599 0.205
NP_442110.1_7 Reverse -102 -116 18.6825 0.0142
NP_442110.1_7 Forward -111 -97 12.3893 0.0586
NP_440014.1_6 Forward -120 -101 12.3892 0.221
NP_440856.1_4 Reverse -95 -114 8.06259 0.06
NP_441083.1_5 Reverse -102 -112 20.3345 0.00053
NP_441083.1_5 Forward -111 -101 11.2881 0.0159
NP_441083.1_5 Reverse -108 -118 6.66654 0.0811
NP_441083.1_5 Forward -117 -107 -0.41329 0.267
NP_442827.1_8 Forward -119 -100 6.39016 0.107
NP_441738.1_2 Forward -109 -102 15.28 0.0102
NP_441738.1_2 Reverse -104 -111 15.28 0.0102
NP_440209.1_1 Reverse -102 -110 18.1123 0.00295
NP_440209.1_1 Forward -111 -103 18.1123 0.00295
NP_442889.1_1 Forward -91 -72 -11.6036 0.218
NP_442889.1_8 Reverse -99 -113 9.6354 0.0952
NP_442889.1_8 Forward -205 -191 4.52221 0.263
NP_442889.1_8 Forward -50 -36 2.94893 0.295
NP_441713.1_1 Reverse -96 -115 -14.9469 0.26
NP_442570.1_3 Forward -171 -152 -5.9004 0.25
NP_442445.1_1 Reverse -262 -281 14.5524 0.188
NP_441716.1_1 Reverse -102 -116 15.7325 0.0467
NP_441716.1_1 Forward -181 -167 5.30946 0.236
NP_441716.1_1 Forward -117 -103 3.44117 0.265
NP_442111.1_4 Forward -112 -98 22.6157 0.000842
NP_442111.1_4 Reverse -101 -115 7.07942 0.105
NP_441163.1_1 Forward -119 -102 8.00291 0.233
NP_440906.1_5 Forward -110 -103 15.8704 0.0124
NP_440906.1_5 Reverse -103 -110 15.8704 0.0124
NP_440747.1_10 Reverse -99 -111 17.1486 0.000663
NP_440747.1_10 Forward -114 -102 7.51213 0.00286
NP_441130.1_10 Forward -113 -99 7.47274 0.158
NP_442973.1_5 Forward -120 -101 12.9791 0.184
NP_441486.1_1 Forward -114 -100 5.80112 0.0344
NP_441486.1_1 Reverse -105 -119 2.06454 0.0918
NP_441486.1_1 Reverse -99 -113 -5.11362 0.222
NP_441486.1_1 Forward -120 -106 -6.19526 0.283
NP_442634.1_4 Reverse -100 -114 7.07942 0.0479
NP_442634.1_4 Forward -113 -99 -1.18038 0.149
NP_441265.1_3 Reverse -96 -110 2.94952 0.181
NP_441014.1_5 Forward -122 -104 9.0656 0.287
NP_442848.1_1 Forward -117 -103 8.35772 0.0791
NP_443018.1_3 Forward -110 -103 14.8871 0.0123
NP_443018.1_3 Reverse -103 -110 14.8871 0.0123
NP_443018.1_3 Forward -116 -109 10.6589 0.0967
NP_443018.1_3 Reverse -109 -116 4.16902 0.278
NP_441316.1_7 Forward -113 -98 -1.5934 0.238
NP_441634.1_8 Reverse -100 -114 -3.73699 0.295
NP_440376.1_1 Forward -111 -102 19.4693 0.000692
NP_440376.1_1 Reverse -102 -111 19.4693 0.000692
NP_442687.1_7 Reverse -101 -111 9.02648 0.0994
NP_442687.1_7 Forward -112 -102 8.92815 0.0994
NP_442687.1_7 Reverse -171 -181 6.27322 0.175
NP_442687.1_7 Reverse -273 -283 5.5849 0.194
NP_442191.1_4 Forward -110 -96 18.2649 0.00956
NP_441846.1_10 Forward -157 -138 -20.1584 0.256
NP_442958.1_2 Forward -119 -100 15.7324 0.289
NP_441013.1_2 Reverse -97 -115 -3.71743 0.29
NP_441422.1_7 Reverse -100 -117 -4.68105 0.247
NP_440533.1_3 Forward -55 -41 17.5025 0.197
NP_442658.1_1 Reverse -100 -110 14.2375 0.0237
NP_442658.1_1 Forward -113 -103 6.76441 0.214
NP_442658.1_9 Reverse -358 -377 16.9124 0.234
NP_442782.1_2 Forward -111 -97 8.16106 0.198
NP_442496.1_5 Forward -154 -136 12.1139 0.207
NP_442205.1_9 Forward -117 -101 -0.236458 0.264
NP_442544.1_2 Reverse -146 -160 -1.47537 0.287
NP_441414.1_9 Forward -111 -92 -4.22878 0.15
NP_441414.1_9 Reverse -102 -121 -6.58872 0.199
NP_442937.1_5 Forward -122 -103 13.1758 0.095
NP_442937.1_5 Forward -186 -167 6.88262 0.268
NP_441958.1_5 Reverse -101 -111 21.2195 0.000805
NP_441958.1_5 Forward -112 -102 12.2714 0.00183
NP_442486.1_1 Forward -114 -95 17.8322 0.212
NP_442836.1_5 Forward -117 -98 1.76941 0.273
NP_440203.1_5 Reverse -105 -115 14.8275 0.0886
NP_440984.1_7 Reverse -97 -111 10.0294 0.126
NP_439990.1_5 Reverse -97 -110 10.639 0.128
NP_442911.1_2 Forward -121 -102 18.4857 0.00604
NP_442911.1_2 Reverse -92 -111 8.75091 0.0195
NP_442911.1_2 Forward -384 -365 -10.522 0.282
NP_440153.1_5 Reverse -103 -117 18.7808 0.0435
NP_440153.1_5 Forward -110 -96 5.30946 0.191
NP_440153.1_5 Forward -180 -166 3.04785 0.219
NP_440993.1_2 Reverse -97 -113 3.59845 0.256
NP_440993.1_3 Reverse -92 -111 15.6332 0.0527
NP_440993.1_3 Forward -121 -102 -1.67294 0.29
NP_440138.1_6 Forward -110 -91 5.99684 0.227
NP_439975.1_3 Forward -150 -137 16.1456 0.231
NP_441348.1_3 Forward -116 -97 8.55425 0.24
NP_441099.1_5 Reverse -98 -117 -8.45701 0.194
NP_441294.1_7 Forward -115 -101 10.0185 0.213
NP_441294.1_7 Reverse -168 -182 9.53859 0.241
NP_441646.1_1 Reverse -95 -114 3.24438 0.207
NP_442438.1_10 Forward -116 -102 16.3225 0.0222
NP_442438.1_10 Reverse -97 -111 1.76955 0.188
NP_442438.1_10 Forward -186 -172 -0.492064 0.264
NP_442771.1_1 Reverse -170 -188 -6.76569 0.169
NP_442771.1_1 Reverse -333 -351 -11.1906 0.299
NP_440484.1_3 Forward -102 -88 11.7993 0.242
NP_440147.1_4 Reverse -100 -113 10.2457 0.0355
NP_440147.1_4 Forward -113 -100 9.16406 0.0428
NP_441175.1_7 Forward -330 -311 8.65258 0.204
NP_441550.1_8 Reverse -100 -110 15.8108 0.0132
NP_441550.1_8 Forward -113 -103 12.3692 0.0336
NP_441550.1_8 Reverse -170 -180 9.02601 0.11
NP_441916.1_7 Forward -111 -101 18.9579 0.00144
NP_441916.1_7 Reverse -102 -112 10.3048 0.0261
NP_441041.1_4 Forward -117 -98 9.53756 0.0316
NP_441041.1_7 Reverse -99 -111 13.3454 0.0485
NP_441547.1_2 Reverse -91 -109 5.91901 0.215
NP_442004.1_6 Reverse -102 -116 11.5043 0.115
NP_441725.1_4 Reverse -97 -111 13.7653 0.0693
NP_441725.1_5 Reverse -103 -113 11.2881 0.0247
NP_441725.1_5 Forward -110 -100 1.94665 0.115
NP_441725.1_5 Reverse -336 -346 0.57002 0.162
NP_441725.1_5 Forward -343 -333 0.373358 0.182
NP_441725.1_5 Forward -46 -36 -1.29827 0.299
NP_439966.1_7 Forward -113 -103 15.8108 0.0124
NP_439966.1_7 Reverse -100 -110 14.3359 0.0203
NP_442941.1_3 Reverse -103 -113 19.9412 0.00262
NP_442941.1_3 Forward -110 -100 19.2529 0.00262
NP_440289.1_2 Reverse -99 -112 3.16588 0.0811
NP_440289.1_2 Forward -114 -101 -2.93064 0.262
NP_440260.1_8 Forward -190 -172 -6.07737 0.285
NP_441514.1_5 Reverse -29 -43 19.2055 0.251
NP_439908.1_5 Reverse -145 -164 8.16093 0.298
NP_442281.1_1 Reverse -97 -111 16.5185 0.00772
NP_442281.1_1 Forward -116 -102 8.25877 0.0832
NP_441334.1_7 Forward -113 -94 -19.8634 0.275
NP_442256.1_2 Reverse -100 -118 1.59244 0.107
NP_442256.1_2 Forward -113 -95 -0.275845 0.139
NP_440479.1_6 Forward -391 -377 12.6836 0.299
NP_440437.1_1 Reverse -96 -115 12.9791 0.0332
NP_442982.1_5 Forward -121 -102 6.19431 0.154
NP_442982.1_5 Reverse -92 -111 -1.27885 0.265
NP_443030.1_4 Reverse -228 -247 -7.86702 0.299
NP_441644.1_6 Forward -111 -101 19.0557 0.000803
NP_441644.1_6 Reverse -102 -112 17.3841 0.00127
NP_441644.1_6 Forward -117 -107 11.6809 0.0448
NP_441644.1_6 Reverse -108 -118 3.32285 0.288
NP_443049.1_6 Forward -337 -327 11.6409 0.24
NP_442215.1_2 Forward -113 -97 -0.236458 0.164
NP_442215.1_2 Reverse -100 -116 -2.39974 0.197
NP_442215.1_2 Forward -183 -167 -6.13632 0.264
NP_442029.1_6 Reverse -97 -116 8.55425 0.205
NP_442029.1_6 Forward -116 -97 5.01433 0.258
NP_442247.1_7 Forward -114 -95 18.879 0.0348
NP_440929.1_8 Forward -111 -102 19.2726 0.000701
NP_440929.1_8 Reverse -102 -111 19.2726 0.000701
NP_442933.1_10 Forward -111 -102 17.601 0.00325
NP_442933.1_10 Reverse -102 -111 17.601 0.00325
NP_441751.2_8 Reverse -103 -117 -0.590395 0.129
NP_441751.2_8 Forward -110 -96 -2.16369 0.132
NP_442554.1_8 Forward -110 -100 17.2863 0.00543
NP_442554.1_8 Reverse -103 -113 15.9097 0.00747
NP_442554.1_8 Reverse -109 -119 11.8781 0.0317
NP_441762.1_7 Reverse -101 -113 -6.74586 0.284
NP_441762.1_7 Forward -112 -100 -6.84419 0.284
NP_442142.1_4 Reverse -99 -112 12.9 0.0406
NP_442142.1_4 Forward -114 -101 6.90188 0.153
NP_442292.1_1 Reverse -103 -112 18.486 0.00229
NP_442292.1_1 Forward -110 -101 17.5026 0.00435
NP_442292.1_1 Reverse -109 -118 5.80125 0.129
NP_441523.1_6 Reverse -98 -117 7.57094 0.194
NP_441523.1_6 Reverse -167 -186 4.71934 0.251
NP_443009.1_5 Forward -112 -101 14.5128 0.02
NP_443009.1_5 Reverse -101 -112 10.1862 0.0792
NP_442408.2_1 Forward -111 -92 -3.24547 0.241
NP_442408.2_1 Reverse -102 -121 -5.11376 0.267
NP_441715.1_4 Forward -110 -100 16.7946 0.0106
NP_441715.1_4 Reverse -103 -113 14.828 0.0268
NP_440183.1_9 Reverse -62 -81 -21.1417 0.296
NP_441468.1_1 Forward -110 -103 15.8704 0.0124
NP_441468.1_1 Reverse -103 -110 15.8704 0.0124
NP_441468.1_1 Forward -116 -109 3.97235 0.277
NP_441618.1_7 Forward -110 -91 13.2096 0.295
NP_441020.2_6 Forward -113 -96 11.8386 0.11
NP_441015.1_9 Forward -386 -373 14.7683 0.292
NP_441015.1_10 Reverse -97 -116 -1.08219 0.169
NP_441015.1_10 Forward -116 -97 -1.08219 0.169
NP_441015.1_10 Forward -158 -139 -4.91709 0.214
NP_441015.1_10 Forward -186 -167 -11.3086 0.294
NP_441015.1_10 Forward -110 -91 -11.3086 0.294
NP_441673.1_1 Forward -111 -102 20.8459 0.000698
NP_441673.1_1 Reverse -102 -111 20.8459 0.000698
NP_441731.1_9 Reverse -258 -275 13.8052 0.223
NP_441826.1_2 Forward -117 -103 23.4024 0.00229
NP_441826.1_2 Reverse -166 -180 9.2427 0.0617
NP_441826.1_2 Reverse -102 -116 2.5562 0.125
NP_441826.1_2 Reverse -96 -110 -1.77037 0.254
NP_441330.1_1 Reverse -97 -116 -12.2919 0.183
NP_442868.1_6 Reverse -100 -110 10.4031 0.038
NP_442868.1_6 Forward -113 -103 9.91146 0.038
NP_441612.1_2 Reverse -102 -112 8.54929 0.21
NP_442361.1_3 Reverse -96 -109 10.049 0.272
NP_442427.1_8 Forward -126 -107 5.50599 0.264
NP_442808.1_1 Reverse -101 -111 8.73102 0.0481
NP_442808.1_1 Forward -112 -102 8.63269 0.0481
NP_442808.1_1 Forward -170 -160 5.38779 0.155
NP_441101.1_10 Reverse -98 -117 -5.9004 0.285
NP_442542.1_2 Reverse -100 -113 9.85238 0.131
NP_442050.1_5 Forward -113 -103 16.4991 0.00812
NP_442050.1_5 Reverse -100 -110 15.9091 0.0091
NP_442050.1_5 Reverse -333 -343 6.76441 0.282
NP_442050.1_8 Forward -117 -98 14.085 0.272
NP_440038.1_4 Reverse -94 -113 0.687771 0.275
NP_442903.1_2 Forward -40 -21 5.49036 0.196
NP_440558.1_2 Reverse -93 -112 -0.787193 0.204
NP_442789.1_4 Reverse -170 -189 -5.21209 0.268
NP_440274.1_2 Forward -276 -262 11.5037 0.26
NP_440274.1_2 Reverse -148 -162 11.4053 0.264
NP_441878.1_6 Reverse -101 -111 10.5014 0.0176
NP_441878.1_6 Forward -112 -102 10.4031 0.0176
NP_441878.1_6 Reverse -171 -181 -0.314959 0.174
NP_441036.1_8 Reverse -101 -111 15.713 0.00724
NP_441036.1_8 Forward -112 -102 8.33817 0.174
NP_442650.1_2 Reverse -102 -116 4.62115 0.165
NP_441557.1_5 Forward -111 -102 19.9609 0.000699
NP_441557.1_5 Reverse -102 -111 19.9609 0.000699
NP_441557.1_8 Reverse -139 -149 11.7793 0.239
NP_441445.1_1 Forward -126 -107 11.7992 0.0796
NP_442777.1_1 Forward -269 -250 10.9134 0.194
NP_441224.1_1 Forward -383 -370 18.3088 0.181
NP_440101.1_3 Reverse -97 -116 0.392778 0.299
NP_440101.1_10 Forward -187 -168 10.7175 0.146
NP_442183.1_1 Reverse -102 -116 7.07942 0.149
NP_442166.1_7 Forward -110 -96 13.3726 0.175
NP_441549.1_9 Forward -115 -97 3.3624 0.0925
NP_442632.1_1 Reverse -5 -24 11.5033 0.254
NP_442347.1_2 Reverse -103 -112 12.4878 0.056
NP_442347.1_2 Forward -110 -101 3.34298 0.284
NP_442645.1_2 Reverse -100 -119 -9.53865 0.142
NP_441037.1_4 Reverse -100 -110 7.22024 0.237
NP_442594.1_8 Forward -158 -139 4.03102 0.274
NP_441633.1_3 Reverse -36 -49 2.08423 0.107
NP_441633.1_3 Forward -183 -170 -1.06236 0.152
NP_441633.1_3 Reverse -100 -113 -3.81562 0.177
NP_441633.1_3 Forward -113 -100 -6.07724 0.236
NP_440136.1_2 Forward -110 -103 15.9687 0.0123
NP_440136.1_2 Reverse -103 -110 15.9687 0.0123
NP_442590.1_10 Forward -117 -98 14.2574 0.123
NP_442590.1_10 Reverse -102 -121 4.03102 0.282
NP_442998.1_10 Forward -109 -102 15.5754 0.0102
NP_442998.1_10 Reverse -104 -111 15.5754 0.0102
NP_440299.1_1 Forward -115 -102 19.9798 0.00161
NP_440299.1_1 Reverse -98 -111 11.1301 0.0518
NP_441799.1_1 Forward -115 -101 8.16044 0.122
NP_441799.1_1 Reverse -98 -112 7.76712 0.133
NP_441007.1_10 Reverse -97 -110 1.29759 0.203
NP_441007.1_10 Forward -116 -103 -0.570702 0.287
NP_440256.1_1 Reverse -99 -118 11.6025 0.0141
NP_440256.1_1 Forward -114 -95 6.4893 0.0296
NP_440456.1_7 Forward -101 -87 11.406 0.285
NP_442283.1_2 Forward -183 -164 8.55425 0.267
NP_441559.1_8 Reverse -97 -111 10.9143 0.0574
NP_441559.1_8 Forward -116 -102 -6.78525 0.279
NP_441559.1_8 Forward -173 -159 -7.67023 0.297
NP_442860.1_7 Reverse -300 -318 8.12684 0.283
NP_440915.1_6 Reverse -98 -112 10.6193 0.0301
NP_440915.1_6 Forward -115 -101 5.1128 0.0935
NP_440915.1_6 Forward -185 -171 -1.77037 0.246
NP_441296.1_7 Reverse -142 -161 12.3892 0.29
NP_440717.1_3 Forward -178 -164 6.98048 0.289
NP_442785.1_7 Reverse -100 -114 11.996 0.228
NP_441704.1_8 Forward -122 -103 7.66846 0.233
NP_442452.1_8 Reverse -96 -110 11.897 0.273
NP_442866.1_1 Forward -301 -282 -5.01543 0.239
NP_441939.1_3 Forward -110 -91 12.2908 0.103
NP_441494.1_6 Reverse -97 -110 6.01747 0.289
NP_439985.1_7 Forward -117 -98 8.84924 0.18
NP_440677.1_6 Reverse -93 -112 8.94757 0.27
NP_442386.1_9 Forward -112 -103 13.8639 0.0289
NP_442386.1_9 Reverse -239 -248 10.324 0.132
NP_442386.1_9 Forward -118 -109 7.96411 0.213
NP_442386.1_9 Reverse -101 -110 6.39082 0.219
NP_442386.1_9 Forward -170 -161 4.7192 0.289
NP_442386.1_9 Reverse -107 -116 4.62087 0.294
NP_441750.1_1 Forward -162 -143 -7.86702 0.27
NP_441340.1_5 Forward -110 -103 15.6737 0.0124
NP_441340.1_5 Reverse -103 -110 15.6737 0.0124
NP_441340.1_5 Reverse -109 -116 11.3472 0.0526
NP_442484.1_2 Reverse -91 -110 1.0811 0.238
NP_440327.1_6 Reverse -256 -275 9.0459 0.212
NP_442240.1_1 Forward -278 -259 7.07848 0.253
NP_442240.1_1 Forward -119 -100 6.58682 0.256
NP_442240.1_2 Forward -110 -91 -19.8634 0.295
NP_441160.1_5 Forward -320 -301 -6.49039 0.288
NP_440586.1_8 Forward -110 -103 13.2151 0.026
NP_440586.1_8 Reverse -103 -110 13.2151 0.026
NP_440586.1_8 Forward -116 -109 5.74197 0.283
NP_442251.1_6 Forward -110 -103 15.2804 0.0124
NP_442251.1_6 Reverse -103 -110 15.2804 0.0124
NP_442251.1_6 Forward -46 -39 10.3639 0.134
NP_440192.1_5 Forward -118 -99 5.40766 0.237
NP_440684.1_9 Forward -117 -103 7.37441 0.266
NP_441262.1_3 Reverse -102 -109 14.7888 0.0223
NP_441262.1_3 Forward -111 -104 14.7888 0.0223
NP_440027.1_8 Reverse -99 -118 10.7167 0.243
NP_440027.1_8 Forward -114 -95 8.94676 0.243
NP_443051.1_1 Reverse -101 -110 19.5676 0.00335
NP_443051.1_1 Forward -112 -103 10.4228 0.00754
NP_439996.1_2 Forward -192 -173 1.96607 0.27
NP_439937.1_9 Reverse -101 -118 -16.0881 0.287
NP_440408.1_7 Forward -111 -92 13.7658 0.175
NP_440408.1_7 Reverse -102 -121 10.6192 0.247
NP_440439.1_1 Reverse -99 -112 10.934 0.0339
NP_440439.1_1 Forward -114 -101 9.2624 0.0465
NP_439943.1_7 Forward -116 -97 11.4058 0.151
NP_440372.1_2 Forward -110 -103 16.3621 0.0124
NP_440372.1_2 Reverse -103 -110 16.3621 0.0124
NP_441138.1_5 Reverse -380 -393 2.92653 0.297
NP_441803.1_2 Reverse -97 -116 4.71934 0.175
NP_439977.1_5 Reverse -96 -115 9.73422 0.0932
NP_439977.1_5 Reverse -323 -342 -2.85214 0.29
NP_441572.1_7 Reverse -96 -115 5.30933 0.0887
NP_441572.1_7 Forward -117 -98 -1.08219 0.186
NP_440267.1_2 Reverse -97 -111 11.5037 0.125
NP_442384.1_10 Reverse -102 -115 18.9972 0.00338
NP_442384.1_10 Forward -111 -98 18.8988 0.00338
NP_442384.1_10 Forward -181 -168 8.37742 0.0656
NP_442384.1_10 Forward -117 -104 5.32916 0.131
NP_442384.1_10 Reverse -60 -73 3.06754 0.203
NP_441018.1_7 Reverse -98 -117 9.63589 0.22
NP_442790.1_4 Forward -120 -101 -0.197208 0.0942
NP_442262.1_10 Forward -110 -103 14.1988 0.0123
NP_442262.1_10 Reverse -103 -110 14.1988 0.0123
NP_442262.1_10 Forward -116 -109 12.0355 0.062
NP_441689.1_5 Forward -113 -103 15.3192 0.0403
NP_441689.1_5 Reverse -100 -110 8.3377 0.132
NP_440344.1_10 Reverse -95 -112 -6.64766 0.114
NP_441965.1_3 Forward -121 -102 2.75272 0.201
NP_441965.1_10 Forward -114 -98 8.41667 0.125
NP_441640.1_8 Forward -116 -97 -4.13045 0.26
NP_440297.1_9 Reverse -103 -113 9.32148 0.0917
NP_440297.1_9 Reverse -336 -346 7.55152 0.11
NP_440297.1_9 Forward -110 -100 -0.216628 0.282
NP_440350.1_5 Reverse -378 -397 -2.95047 0.253
NP_442280.1_10 Forward -221 -203 7.01283 0.268
NP_441896.1_5 Reverse -261 -268 12.2322 0.273
NP_440894.1_10 Reverse -97 -116 2.65439 0.286
NP_442067.1_3 Forward -324 -305 15.4374 0.224
NP_440999.1_9 Reverse -98 -112 10.226 0.0548
NP_440999.1_9 Forward -389 -375 2.94952 0.14
NP_440999.1_9 Reverse -168 -182 1.47456 0.164
NP_440999.1_9 Forward -115 -101 -0.197071 0.201
NP_440888.1_2 Reverse -102 -116 20.4518 0.000632
NP_440888.1_2 Forward -111 -97 15.9285 0.00837
NP_440888.1_2 Reverse -172 -186 7.66879 0.186
NP_440600.1_4 Reverse -94 -112 -0.964162 0.16
NP_440600.1_4 Forward -119 -101 -4.01242 0.249
NP_440491.1_1 Forward -114 -95 18.2221 0.0471
NP_442277.1_4 Forward -120 -101 10.52 0.0949
NP_442277.1_4 Reverse -93 -112 4.81688 0.184
NP_442033.1_10 Forward -181 -162 -14.5535 0.299
NP_441543.1_2 Reverse -103 -112 16.9127 0.00359
NP_441543.1_2 Forward -110 -101 15.9293 0.00518
NP_441543.1_2 Reverse -109 -118 5.3096 0.204
NP_442845.1_2 Forward -117 -103 17.0108 0.0608
NP_442845.1_2 Reverse -102 -116 16.8142 0.0608
NP_441551.1_5 Forward -115 -99 9.00595 0.222
NP_441319.1_6 Forward -113 -94 18.584 0.163
NP_441469.1_8 Reverse -101 -110 6.5879 0.227
NP_441469.1_8 Forward -112 -103 6.48957 0.227
NP_443064.1_6 Reverse -102 -112 12.5669 0.0796
NP_443064.1_6 Forward -111 -101 10.8217 0.13
NP_442578.1_7 Forward -110 -103 14.5921 0.026
NP_442578.1_7 Reverse -103 -110 14.5921 0.026
NP_440710.1_1 Reverse -94 -112 -8.43732 0.264
NP_441462.1_2 Forward -111 -101 20.2362 0.000805
NP_441462.1_2 Reverse -102 -112 11.5831 0.00406
NP_441621.1_7 Forward -113 -99 -5.11362 0.248
NP_443062.1_1 Forward -111 -93 16.054 0.0326
NP_443062.1_6 Forward -119 -100 0.294447 0.299
NP_441601.1_2 Forward -123 -104 -0.4922 0.219
NP_442204.1_1 Reverse -98 -109 21.1015 0.0035
NP_442204.1_1 Forward -115 -104 7.92515 0.108
NP_442204.1_2 Forward -121 -102 12.4875 0.223
NP_442204.1_2 Reverse -92 -111 8.84924 0.239
NP_442204.1_5 Forward -121 -102 5.50599 0.156
NP_440516.1_8 Forward -111 -102 16.9127 0.00442
NP_440516.1_8 Reverse -102 -111 16.9127 0.00442
NP_440516.1_8 Forward -117 -108 7.17789 0.0754
NP_442428.1_5 Forward -110 -103 15.8704 0.0124
NP_442428.1_5 Reverse -103 -110 15.8704 0.0124
NP_442428.1_5 Forward -116 -109 4.36568 0.271
NP_442859.1_2 Forward -116 -97 4.52268 0.214
NP_442120.1_10 Forward -117 -98 -7.67036 0.222
NP_442823.1_9 Reverse -149 -168 14.8629 0.239
NP_441867.1_4 Reverse -358 -377 23.5989 0.00186
NP_440673.1_3 Forward -109 -102 12.4288 0.0426
NP_440673.1_3 Reverse -104 -111 12.4288 0.0426
NP_440673.1_7 Forward -122 -103 9.93088 0.111
NP_440673.1_7 Reverse -91 -110 4.52268 0.185
NP_440865.1_9 Forward -117 -98 -7.37537 0.244
NP_441052.1_2 Reverse -102 -112 19.9412 0.00106
NP_441052.1_2 Reverse -172 -182 11.5831 0.0285
NP_441052.1_2 Forward -111 -101 10.4031 0.0285
NP_441052.1_2 Reverse -108 -118 7.94484 0.0576
NP_441052.1_2 Forward -181 -171 1.94665 0.221
NP_441052.1_2 Forward -336 -326 1.16001 0.25
NP_440992.1_2 Forward -168 -149 12.7825 0.202
NP_442219.1_8 Forward -340 -321 9.61661 0.224
NP_442219.1_9 Reverse -103 -112 17.7976 0.00718
NP_442219.1_9 Forward -110 -101 8.25953 0.0681
NP_440436.1_4 Reverse -103 -112 17.2072 0.00233
NP_440436.1_4 Forward -110 -101 9.24241 0.0871
NP_440436.1_4 Reverse -109 -118 4.7192 0.244
NP_441884.1_8 Forward -112 -93 -9.63698 0.268
NP_441884.1_9 Reverse -99 -118 -22.715 0.284
NP_440648.1_1 Forward -111 -92 5.30933 0.219
NP_441719.1_4 Forward -110 -103 16.3621 0.0124
NP_441719.1_4 Reverse -103 -110 16.3621 0.0124
NP_441004.1_1 Forward -162 -143 -5.31042 0.175
NP_441004.1_1 Forward -117 -98 -11.9969 0.243
NP_441004.1_2 Reverse -257 -276 -2.16383 0.263
NP_442366.1_3 Reverse -101 -119 6.214 0.0809
NP_442366.1_3 Forward -112 -94 4.9357 0.0899
NP_440129.1_10 Reverse -95 -109 5.30946 0.185
NP_441115.1_4 Reverse -101 -119 16.4396 0.0279
NP_441115.1_4 Forward -112 -94 10.2448 0.183
NP_442206.1_10 Forward -111 -96 4.40479 0.178
NP_442854.1_4 Reverse -97 -116 14.7483 0.224
NP_440328.1_4 Forward -117 -98 9.93088 0.092
NP_441851.1_10 Forward -112 -102 15.8113 0.00552
NP_441851.1_10 Reverse -101 -111 8.53483 0.114
NP_441851.1_10 Forward -100 -90 7.55152 0.137
NP_441851.1_10 Forward -48 -38 4.69992 0.254
NP_442208.1_5 Forward -113 -94 0.392778 0.248
NP_442856.1_7 Reverse -93 -112 4.916 0.131
NP_441668.1_4 Forward -121 -102 -0.39387 0.252
NP_442515.1_1 Reverse -37 -51 1.37622 0.161
NP_442515.1_1 Reverse -101 -115 0.196253 0.2
NP_442515.1_1 Forward -48 -34 -3.44199 0.29
NP_442515.1_1 Forward -112 -98 -4.62196 0.298
NP_441683.1_7 Forward -156 -137 3.6377 0.241
NP_440593.1_3 Reverse -167 -186 -5.80207 0.266
NP_440593.1_3 Forward -116 -97 -5.9004 0.268
NP_440165.1_5 Forward -112 -93 -6.29373 0.231
NP_441349.1_10 Reverse -92 -111 8.84924 0.0258
NP_441349.1_10 Forward -121 -102 3.04771 0.0704
NP_441409.1_6 Forward -117 -98 -1.27885 0.0757
NP_441409.1_8 Reverse -292 -311 12.4153 0.209
NP_440432.1_9 Forward -110 -95 -2.97003 0.177
NP_440726.1_2 Reverse -92 -111 0.687771 0.285
NP_441477.1_5 Forward -382 -363 7.37428 0.277
NP_441477.1_10 Forward -118 -100 18.5054 0.0842
NP_440431.1_3 Reverse -299 -318 -9.34199 0.244
NP_442450.1_5 Forward -113 -103 9.32148 0.115
NP_440588.1_2 Forward -120 -101 6.98095 0.0532
NP_440588.1_2 Reverse -93 -112 6.88262 0.0535
NP_440195.1_5 Forward -342 -323 0.786102 0.295
NP_442006.1_2 Forward -156 -139 -18.7424 0.295
NP_442243.1_1 Reverse -96 -114 1.10005 0.22
NP_441570.1_1 Forward -111 -93 -0.964162 0.0525
NP_441570.1_1 Forward -117 -99 -7.35568 0.0887
NP_441570.1_1 Reverse -102 -120 -7.84733 0.0968
NP_441078.1_4 Forward -111 -102 19.6659 0.0007
NP_441078.1_4 Reverse -102 -111 19.6659 0.0007
NP_441078.1_4 Forward -181 -172 -1.96689 0.282
NP_442729.1_8 Forward -115 -102 8.47575 0.125
NP_441663.1_8 Reverse -96 -115 4.22769 0.169
NP_442348.1_2 Forward -320 -311 11.8978 0.225
NP_440707.1_6 Reverse -94 -113 16.3215 0.172
NP_440526.1_3 Reverse -109 -120 1.04151 0.267
NP_440526.1_3 Reverse -103 -114 0.844851 0.267
NP_441432.1_8 Reverse -101 -110 16.8143 0.00595
NP_441432.1_8 Forward -112 -103 16.8143 0.00595
NP_441432.1_8 Forward -70 -61 5.40793 0.158
NP_441432.1_8 Forward -118 -109 4.22796 0.235
NP_441432.1_9 Reverse -382 -395 10.6345 0.245
NP_442320.1_8 Forward -117 -103 3.8345 0.0578
NP_441732.1_2 Reverse -98 -114 12.6449 0.00384
NP_441732.1_2 Forward -115 -99 -7.51295 0.0859
NP_440759.1_3 Reverse -236 -255 -1.57384 0.269
NP_440760.1_1 Reverse -102 -121 -14.9469 0.138
NP_440760.1_1 Forward -111 -92 -21.7317 0.243
NP_442797.1_7 Reverse -95 -113 -1.45582 0.299
NP_440199.1_10 Forward -114 -104 15.5163 0.0861
NP_440199.1_10 Reverse -105 -115 7.25653 0.231
NP_440713.1_4 Forward -121 -102 3.53937 0.242
NP_442489.1_7 Forward -111 -102 20.1576 0.000695
NP_442489.1_7 Reverse -102 -111 20.1576 0.000695
NP_442489.1_7 Forward -117 -108 -1.47524 0.203
NP_442489.1_7 Forward -181 -172 -1.6719 0.235
NP_440559.1_1 Reverse -103 -112 17.4043 0.00658
NP_440559.1_1 Forward -110 -101 8.65285 0.0586
NP_440559.1_1 Reverse -109 -118 5.01461 0.161
NP_441659.2_8 Forward -111 -101 20.9245 0.000805
NP_441659.2_8 Reverse -102 -112 18.1713 0.00133
NP_442913.1_10 Reverse -93 -112 16.7157 0.0136
NP_442913.1_10 Reverse -163 -182 2.3594 0.126
NP_442913.1_10 Forward -120 -101 -2.26216 0.183
NP_441040.1_2 Forward -119 -100 -14.0619 0.284
NP_442008.1_2 Reverse -99 -118 13.0775 0.0978
NP_442008.1_2 Forward -114 -95 12.9791 0.0978
NP_442776.1_1 Reverse -5 -24 8.06259 0.202
NP_442346.1_5 Forward -112 -102 16.6963 0.00248
NP_442346.1_5 Reverse -101 -111 16.303 0.00248
NP_442346.1_5 Reverse -171 -181 9.02648 0.118
NP_442346.1_5 Forward -182 -172 8.1415 0.146
NP_440545.1_3 Forward -115 -98 14.5918 0.0149
NP_440545.1_3 Reverse -98 -115 7.512 0.0496
NP_440545.1_3 Forward -185 -168 -2.81276 0.193
NP_441856.1_3 Forward -114 -95 7.47261 0.102
NP_440025.1_3 Forward -286 -272 9.64265 0.294
NP_441629.1_3 Reverse -95 -114 -4.62285 0.296
NP_440459.1_2 Reverse -100 -117 15.0835 0.116
NP_440459.1_2 Reverse -145 -162 9.77361 0.219
NP_440459.1_2 Reverse -227 -244 8.20031 0.267
NP_440010.1_4 Reverse -98 -117 2.35861 0.225
NP_442551.1_4 Forward -183 -168 -3.36336 0.287
NP_441168.1_7 Reverse -359 -378 24.9755 0.0145
NP_442603.1_7 Reverse -102 -116 22.5167 0.00306
NP_442603.1_7 Forward -111 -97 10.5204 0.125
NP_442603.1_7 Forward -181 -167 7.27547 0.211
NP_441233.1_2 Forward -189 -170 19.6656 0.122
NP_441888.1_7 Forward -174 -160 5.01447 0.225
NP_441888.1_7 Reverse -97 -111 3.8345 0.225
NP_440449.1_6 Forward -119 -101 10.2011 0.159
NP_440449.1_6 Reverse -164 -182 4.36531 0.297
NP_440170.1_2 Reverse -96 -115 2.75272 0.297
NP_440170.1_6 Reverse -97 -116 19.5673 0.0959
NP_441833.1_4 Forward -110 -103 15.9687 0.0124
NP_441833.1_4 Reverse -103 -110 15.9687 0.0124
NP_441329.1_4 Reverse -29 -47 11.27 0.251
NP_442162.1_9 Forward -110 -103 16.2637 0.0124
NP_442162.1_9 Reverse -103 -110 16.2637 0.0124
NP_440671.1_4 Forward -117 -103 11.111 0.141
NP_440772.1_10 Reverse -196 -215 11.6469 0.261
NP_442140.1_3 Forward -110 -100 4.69992 0.238
NP_442140.1_3 Reverse -103 -113 4.40493 0.243
NP_440875.1_9 Forward -109 -99 16.5483 0.0145
NP_441813.1_5 Reverse -100 -110 18.1713 0.00743
NP_441813.1_5 Forward -113 -103 15.9097 0.01
NP_440590.1_4 Reverse -103 -116 12.704 0.013
NP_440590.1_4 Forward -110 -97 4.44418 0.0601
NP_440590.1_4 Reverse -109 -122 1.10092 0.133
NP_440567.1_1 Reverse -103 -117 13.3726 0.0213
NP_440567.1_1 Forward -110 -96 6.78443 0.0803
NP_442497.1_10 Forward -110 -101 17.601 0.00813
NP_442497.1_10 Reverse -103 -112 10.4228 0.0087
NP_440821.1_4 Forward -113 -103 18.2696 0.00448
NP_440821.1_4 Reverse -100 -110 2.24165 0.131
NP_440821.1_4 Forward -346 -336 0.0783647 0.205
NP_440821.1_4 Forward -49 -39 -0.609952 0.279
NP_441239.1_9 Reverse -100 -112 13.0187 0.0389
NP_441239.1_9 Forward -113 -101 4.36554 0.253
NP_441009.1_4 Forward -111 -92 17.7974 0.131
NP_441009.1_4 Forward -168 -149 11.7008 0.254
NP_441892.1_1 Forward -120 -103 2.30045 0.141
NP_441892.1_1 Reverse -93 -110 -2.41943 0.221
NP_440604.1_6 Forward -111 -92 15.9291 0.0305
NP_440796.1_3 Forward -118 -100 10.5398 0.204
NP_442643.1_1 Forward -117 -98 -11.2103 0.231
NP_441874.1_1 Forward -159 -145 16.1259 0.165
NP_440354.1_5 Reverse -99 -118 8.55425 0.174
NP_440546.1_4 Forward -111 -101 13.5365 0.0459
NP_440546.1_4 Reverse -102 -112 10.046 0.109
NP_440546.1_4 Forward -117 -107 8.00989 0.209
NP_440546.1_4 Reverse -108 -118 6.65249 0.288
NP_441230.1_5 Reverse -97 -116 3.14605 0.205
NP_440462.1_6 Reverse -100 -110 18.7612 0.00454
NP_440462.1_6 Forward -113 -103 7.74818 0.0699
NP_442611.1_1 Forward -111 -92 6.88262 0.155
NP_440868.1_4 Forward -115 -103 8.6921 0.0582
NP_440868.1_4 Reverse -98 -110 8.00379 0.0602
NP_442402.1_1 Reverse -141 -160 12.2908 0.24
NP_442402.1_4 Reverse -94 -113 -7.96609 0.278
NP_442402.1_4 Reverse -164 -183 -10.2277 0.298
NP_442402.1_10 Reverse -92 -102 13.3526 0.204
NP_441084.1_6 Reverse -100 -114 10.4106 0.241
NP_441084.1_6 Reverse -298 -312 9.92586 0.257
NP_440653.1_10 Reverse -148 -167 4.42435 0.252
NP_442039.1_4 Forward -110 -103 15.1821 0.0124
NP_442039.1_4 Reverse -103 -110 15.1821 0.0124
NP_441811.1_1 Reverse -219 -238 6.88262 0.28
NP_441811.1_8 Forward -117 -103 7.66941 0.241
NP_440825.1_6 Forward -264 -245 12.8808 0.249
NP_442837.1_3 Forward -110 -103 15.7721 0.0124
NP_442837.1_3 Reverse -103 -110 15.7721 0.0124
NP_439994.1_3 Reverse -101 -120 16.1451 0.0785
NP_442053.1_1 Forward -111 -102 18.3876 0.0007
NP_442053.1_1 Reverse -102 -111 18.3876 0.0007
NP_442053.1_1 Forward -117 -108 6.09625 0.147
NP_440505.1_3 Reverse -100 -110 17.188 0.00332
NP_440505.1_3 Forward -113 -103 16.303 0.00696
NP_440505.1_3 Forward -71 -61 4.79825 0.266
NP_441203.1_1 Forward -110 -91 -2.75381 0.0655
NP_441203.1_1 Reverse -103 -122 -10.7186 0.137
NP_442532.1_4 Reverse -356 -374 8.83755 0.278
NP_441408.2_7 Reverse -100 -119 1.67108 0.215
NP_440914.1_1 Reverse -102 -112 17.5935 0.000537
NP_440914.1_1 Forward -111 -101 16.3248 0.00196
NP_440914.1_1 Forward -117 -107 13.2019 0.0378
NP_440914.1_1 Reverse -240 -250 6.17532 0.293
NP_441011.1_8 Forward -110 -101 16.6177 0.00602
NP_441011.1_8 Reverse -103 -112 8.25953 0.144
NP_442101.1_10 Reverse -94 -113 -6.1954 0.183
NP_442533.1_1 Forward -114 -95 -15.3402 0.254
NP_442533.1_6 Forward -111 -102 17.2076 0.00137
NP_442533.1_6 Reverse -102 -111 17.2076 0.00137
NP_442533.1_6 Reverse -172 -181 5.11294 0.155
NP_442533.1_6 Forward -117 -108 3.93297 0.197
NP_442533.1_6 Forward -181 -172 3.83464 0.202
NP_442232.1_3 Reverse -164 -183 -11.6036 0.282
NP_442232.1_3 Forward -103 -84 -13.9635 0.286
NP_442232.1_3 Forward -119 -100 -14.0619 0.287
NP_441482.1_7 Reverse -96 -110 6.88276 0.0257
NP_441482.1_7 Forward -117 -103 -8.65353 0.193
NP_439944.1_9 Reverse -103 -113 19.0562 0.00329
NP_439944.1_9 Reverse -336 -346 9.91146 0.0963
NP_439944.1_9 Forward -110 -100 9.12481 0.1
NP_442269.1_10 Forward -186 -167 7.47261 0.194
NP_442269.1_10 Reverse -84 -103 5.40766 0.238
NP_441028.1_6 Reverse -141 -151 5.68278 0.243
NP_440116.1_5 Forward -114 -97 3.48043 0.233
NP_440116.1_8 Forward -110 -91 4.12936 0.0747
NP_441527.1_4 Forward -395 -376 -10.8388 0.275
NP_441527.1_4 Forward -398 -379 -12.0802 0.285
NP_441527.1_8 Reverse -269 -288 8.35759 0.279
NP_440115.1_6 Reverse -99 -109 14.0414 0.0615
NP_440115.1_6 Forward -114 -104 8.4365 0.13
NP_440007.1_9 Reverse -98 -112 10.226 0.163
NP_440007.1_9 Forward -115 -101 2.16287 0.281
NP_440007.1_9 Reverse -156 -170 1.08123 0.29
NP_443045.1_2 Forward -391 -372 13.1758 0.287
NP_441602.1_3 Forward -186 -167 -2.45882 0.233
NP_441602.1_3 Forward -116 -97 -2.95047 0.239
NP_441170.1_4 Forward -190 -172 3.06741 0.283
NP_441972.1_5 Forward -180 -161 7.37428 0.0748
NP_441972.1_5 Forward -110 -91 -6.78538 0.235
NP_441106.1_1 Reverse -101 -110 18.486 0.0028
NP_441106.1_1 Forward -112 -103 9.63616 0.0311
NP_439903.1_6 Reverse -99 -118 12.0933 0.0872
NP_441286.1_1 Reverse -101 -113 11.937 0.0108
NP_441286.1_1 Forward -112 -100 5.93884 0.0258
NP_441286.1_1 Forward -118 -106 0.825626 0.107
NP_441286.1_1 Forward -182 -170 -5.07423 0.188
NP_441286.1_1 Reverse -37 -49 -5.76255 0.223
NP_441286.1_1 Forward -345 -333 -6.94252 0.288
NP_440670.1_8 Forward -111 -102 18.3876 0.000699
NP_440670.1_8 Reverse -102 -111 18.3876 0.000699
NP_440886.1_7 Reverse -101 -111 8.04271 0.0805
NP_440886.1_7 Forward -112 -102 7.94438 0.0805
NP_440886.1_7 Reverse -146 -156 4.7978 0.218
NP_442614.1_2 Reverse -102 -116 7.17775 0.275
NP_442614.1_2 Reverse -169 -183 5.70279 0.298
NP_442072.1_9 Reverse -101 -119 -21.8103 0.212
NP_442072.1_9 Forward -112 -94 -22.007 0.216
NP_442963.1_6 Forward -338 -319 16.1734 0.266
NP_440907.2_8 Forward -110 -100 9.616 0.103
NP_441021.1_1 Forward -282 -263 -8.752 0.2
NP_440841.1_4 Forward -113 -94 -8.16202 0.25
NP_440841.1_4 Reverse -106 -125 -8.26035 0.25
NP_441626.1_2 Forward -110 -103 15.7721 0.0124
NP_441626.1_2 Reverse -103 -110 15.7721 0.0124
NP_441626.1_2 Forward -343 -336 5.05399 0.238
NP_442365.1_7 Forward -115 -96 1.96607 0.168
NP_442365.1_7 Reverse -98 -117 -2.75381 0.204
NP_442794.1_1 Reverse -98 -110 10.5604 0.0721
NP_442794.1_1 Forward -115 -103 10.1671 0.0721
NP_441401.1_5 Reverse -163 -182 11.6018 0.297
NP_442615.1_1 Reverse -93 -111 1.78911 0.0793
NP_441962.1_4 Reverse -170 -189 -14.1602 0.284
NP_440387.1_1 Reverse -102 -118 6.35172 0.0282
NP_440387.1_1 Forward -111 -95 -1.3181 0.142
NP_440387.1_1 Forward -117 -101 -6.23465 0.273
NP_441431.1_2 Reverse -99 -113 6.58715 0.266
NP_441488.1_8 Reverse -97 -111 9.73373 0.146
NP_441993.1_1 Forward -117 -98 19.0992 0.0367
NP_441993.1_1 Reverse -102 -121 2.8238 0.25
NP_441174.1_4 Forward -151 -141 15.713 0.238
NP_442323.1_7 Reverse -97 -116 17.5998 0.042
NP_442323.1_7 Forward -116 -97 13.8633 0.0824
NP_440311.1_3 Reverse -195 -214 12.0942 0.297
NP_440725.1_4 Reverse -155 -174 0.58944 0.232
NP_441510.2_7 Reverse -223 -237 11.7003 0.28
NP_441510.2_7 Forward -117 -103 9.43874 0.281
NP_440766.1_4 Forward -115 -101 7.86607 0.0871
NP_440766.1_4 Reverse -104 -118 0.687908 0.271
NP_440422.1_10 Reverse -376 -395 7.79033 0.221
NP_441237.1_9 Reverse -109 -119 11.7798 0.156
NP_442743.1_4 Forward -110 -91 9.3409 0.0547
NP_442743.1_4 Forward -180 -161 -6.39206 0.279
NP_442743.1_5 Forward -168 -149 5.211 0.206
NP_441311.1_2 Reverse -96 -110 14.7486 0.229
NP_440457.1_1 Forward -115 -103 8.88877 0.101
NP_440457.1_1 Reverse -98 -110 7.70879 0.101
NP_440213.1_4 Reverse -361 -380 14.9613 0.258
NP_440987.1_8 Forward -311 -297 22.4191 0.141
NP_440798.1_6 Forward -110 -97 2.08423 0.186
NP_441801.1_4 Reverse -7 -17 2.63497 0.29
NP_440142.1_2 Reverse -373 -387 19.7641 0.245
NP_441436.1_8 Forward -112 -93 7.37428 0.293
NP_441436.1_9 Forward -272 -262 16.5975 0.27
NP_442509.1_9 Reverse -102 -112 8.14104 0.192
NP_442509.1_9 Forward -111 -101 8.04271 0.192
NP_442509.1_9 Forward -178 -168 6.56775 0.263
NP_442509.1_9 Reverse -38 -48 6.46942 0.268
NP_442509.1_9 Forward -330 -320 6.37109 0.274
NP_440554.1_4 Forward -110 -100 17.9746 0.0131
NP_440554.1_4 Reverse -103 -113 7.05986 0.106
NP_441885.1_5 Reverse -102 -112 20.9245 0.000538
NP_441885.1_5 Forward -111 -101 11.3864 0.00668
NP_441885.1_5 Reverse -108 -118 -0.41329 0.197
NP_440478.1_4 Reverse -98 -117 19.9606 0.0246
NP_440649.2_5 Forward -112 -93 12.8808 0.232
NP_442341.1_7 Reverse -101 -115 9.2427 0.0751
NP_442341.1_7 Forward -112 -98 1.67122 0.282
NP_442341.1_9 Reverse -100 -114 18.5835 0.0166
NP_442341.1_9 Reverse -106 -120 4.91554 0.287
NP_441756.1_5 Reverse -98 -117 0.687771 0.228
NP_441756.1_5 Forward -115 -96 -3.3438 0.29
NP_441173.1_9 Reverse -151 -159 10.9338 0.242
NP_442395.2_4 Forward -112 -93 6.48849 0.146
NP_442395.2_4 Reverse -101 -120 1.17865 0.249
NP_440423.1_6 Reverse -154 -173 -19.9617 0.248
NP_443000.1_7 Reverse -100 -110 20.3345 0.00223
NP_443000.1_7 Forward -113 -103 17.0896 0.00865
NP_440552.1_8 Forward -207 -190 9.60133 0.293
NP_441842.1_10 Forward -118 -104 9.34103 0.192
NP_440275.1_3 Reverse -100 -110 16.1063 0.0155
NP_440275.1_3 Forward -113 -103 8.1415 0.0602
NP_440275.1_3 Forward -140 -130 6.27322 0.118
NP_440091.1_1 Forward -115 -103 6.43049 0.095
NP_442451.1_2 Forward -119 -100 -4.52377 0.211
NP_442451.1_2 Reverse -30 -49 -9.63698 0.259
NP_442495.1_4 Forward -107 -97 16.303 0.0771
NP_440149.1_8 Reverse -102 -121 -0.197208 0.146
NP_440149.1_8 Forward -111 -92 -4.6221 0.211
NP_441105.1_3 Forward -122 -103 6.39097 0.0614
NP_441105.1_3 Reverse -91 -110 -0.000545616 0.131
NP_441105.1_3 Reverse -289 -308 -8.752 0.278
NP_442373.1_1 Reverse -163 -182 -1.18052 0.183
NP_440216.1_1 Forward -111 -97 17.1092 0.00188
NP_440216.1_1 Reverse -102 -116 0.392915 0.0284
NP_440216.1_6 Forward -118 -102 6.84337 0.189
NP_440172.1_1 Forward -111 -101 17.5813 0.00421
NP_440172.1_1 Reverse -102 -112 15.0247 0.00945
NP_440172.1_1 Forward -117 -107 10.3048 0.0524
NP_441064.1_6 Reverse -356 -375 18.6823 0.0525
NP_442015.1_10 Forward -115 -102 19.2922 0.00444
NP_442015.1_10 Reverse -98 -111 13.4906 0.0354
NP_442015.1_10 Forward -173 -160 -0.275709 0.259
NP_441226.1_4 Reverse -255 -274 7.86593 0.289
NP_441226.1_7 Forward -110 -103 14.4934 0.0123
NP_441226.1_7 Reverse -103 -110 14.4934 0.0123
NP_441226.1_7 Reverse -109 -116 12.4284 0.0404
NP_441111.1_7 Forward -110 -102 18.7023 0.00294
NP_441111.1_7 Reverse -103 -111 18.7023 0.00294
NP_442379.1_10 Forward -118 -101 5.74204 0.126
NP_441766.1_2 Forward -111 -102 17.5026 0.00297
NP_441766.1_2 Reverse -102 -111 17.5026 0.00297
NP_442417.1_5 Forward -111 -97 14.3559 0.0633
NP_440416.1_9 Reverse -95 -114 4.42435 0.0355
NP_440416.1_9 Forward -118 -99 1.27776 0.0468
NP_443052.1_9 Forward -173 -154 -2.55715 0.239
NP_443052.1_9 Reverse -143 -162 -4.32711 0.257
NP_442403.1_8 Forward -115 -96 -2.65548 0.278
NP_440591.1_9 Forward -118 -100 14.6705 0.085
NP_440261.1_5 Forward -110 -97 6.70579 0.0318
NP_440261.1_5 Reverse -103 -116 -2.63565 0.0924
NP_440261.1_5 Forward -180 -167 -4.60227 0.158
NP_440988.1_10 Reverse -106 -120 8.38408 0.205
NP_440988.1_10 Forward -113 -99 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGTACAAAAAGCAGCAGAAACAGCCCTCAGTTTGCCAGAAAGTTACATTGAAGTAGTGCGAAAGCGCTATCAAGAACGGCGGGACTTTGTTATTAATGGCTTGAGTAAATTGGGTTGGTCTATTACCCCTTCCCAAGCCACCATGTACCTTTGGGTTCCCTGTCCCGTGGGTATGAGTTCCACTGATTTTGCCTTAACGGTTCTAGAAAAAACCGGTGTGGTGATGACCCCCGGTAACGCCTTTGGAGAAGGGGGAGAAAGGTACGTCCGCTTAAGTTTAATTGCCGATGGCGATCGCCTGGGGGAAGCATTACAGCGCATTGAACAGGCAGGCATTCGTTATAGTTGATTGGTGCGATTACAATCAATTAACACTTAAATCCTCTGGGGAGTGAAGTAG

CDS

ATGGTTTTAGCCTCAGCAAAAGTACCAACCCTTTCCCTGGAATCATTCTTGGCCCTACCGGAAACCAAACCTGCCCAGGAATATTGCCGGGGCATTGTCACCCAGAAACCCATGCCCAAAGGTAAACACAGCACAATCCAATTTGAGCTAGCGGCCGCTATTAATGCCCAAGTGAAGCCGGACAAAATTGCCTATGCTCTGCCGGAACTTCGTTGTACCTTTGGCGATCGCTCCATTGTGCCTGACATTGCGGTGATGCGCTGGCAAAACTTGCCTTTAGATAATGGTGGCGAAATAGCAGACCGGTTTGATCGGGCCCCGGATTGGCTCATAGAAATTCTTTCCCCAGATCAGTCGGTCACCCTGGTAATGGAAAAAATCATTTTTTCTCTCAAGGCTGGCACAGAATTAGCTTGGTTAGTGGATCCCATGGCCAAATCCATTACGGTTTTCACCGCCAGTTTACCCCAGGTTTATTTAGCTGAAACTGAAATTCAAGAATCCCTAACGGTTTTTGCTGAGCTTGAAAATTGGTCCATTACCGCCGCCGAAGTTTTTGATTGGCTAAAAATTTAG

Protein

MVLASAKVPTLSLESFLALPETKPAQEYCRGIVTQKPMPKGKHSTIQFELAAAINAQVKPDKIAYALPELRCTFGDRSIVPDIAVMRWQNLPLDNGGEIADRFDRAPDWLIEILSPDQSVTLVMEKIIFSLKAGTELAWLVDPMAKSITVFTASLPQVYLAETEIQESLTVFAELENWSITAAEVFDWLKI