Your browser is old and dusty. Try Google Chrome!

Details for sgl0002

ORF sgl0002
Accession NP_440043.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -81 -67 0.88457 0.197
NP_441061.1_2 Forward -377 -363 -1.18038 0.252
NP_441418.1_6 Forward -82 -63 -29.7948 0.238
NP_440897.1_6 Forward -195 -176 10.1267 0.0705
NP_441453.1_4 Reverse -186 -194 6.80426 0.121
NP_441453.1_4 Forward -195 -187 6.11594 0.121
NP_441623.1_1 Reverse -227 -245 -3.22577 0.256
NP_442151.1_1 Reverse -357 -376 3.73603 0.287
NP_442151.1_6 Reverse -186 -200 9.63603 0.142
NP_440226.1_1 Reverse -369 -388 2.45773 0.263
NP_442744.1_8 Forward -378 -359 2.75272 0.194
NP_442173.1_1 Forward -194 -186 12.0158 0.0316
NP_442173.1_1 Reverse -187 -195 4.83764 0.241
NP_442752.1_4 Reverse -186 -193 13.8055 0.0199
NP_442752.1_4 Forward -270 -263 5.54565 0.194
NP_442752.1_4 Reverse -362 -369 5.25066 0.256
NP_441812.1_2 Forward -298 -279 13.8641 0.226
NP_442975.1_10 Reverse -365 -379 1.76896 0.291
NP_440784.1_7 Reverse -187 -194 6.23397 0.241
NP_440784.1_7 Forward -194 -187 6.13563 0.241
NP_440784.1_8 Reverse -69 -88 19.5673 0.138
NP_440061.1_9 Forward -373 -359 7.66879 0.198
NP_440061.1_9 Forward -400 -386 6.19383 0.255
NP_442062.1_8 Forward -378 -368 8.04317 0.0816
NP_441900.1_2 Forward -333 -315 -4.99644 0.288
NP_441900.1_2 Reverse -268 -286 -6.4714 0.294
NP_441859.1_3 Reverse -72 -91 2.16195 0.266
NP_440304.1_4 Forward -380 -370 7.35486 0.118
NP_440044.1_2 Forward -363 -344 19.4681 0.18
NP_440044.1_5 Forward -300 -281 18.289 0.13
NP_440044.1_7 Forward -252 -234 17.4037 0.269
NP_442048.1_9 Forward -70 -51 9.3409 0.276
NP_441935.1_10 Forward -89 -70 19.5673 0.0924
NP_441208.1_9 Forward -374 -360 6.48943 0.244
NP_441208.1_9 Forward -232 -218 4.91614 0.282
NP_440764.1_3 Forward -77 -59 10.1472 0.277
NP_441594.1_6 Forward -252 -233 0.0977854 0.293
NP_441594.1_6 Reverse -360 -379 -0.0988766 0.297
NP_441925.1_4 Reverse -54 -73 -13.1776 0.257
NP_441083.1_5 Forward -195 -185 8.82982 0.03
NP_441083.1_5 Reverse -186 -196 7.05986 0.067
NP_441083.1_5 Forward -398 -388 5.87989 0.0995
NP_442827.1_8 Reverse -361 -380 -2.8529 0.29
NP_441738.1_2 Forward -193 -186 15.28 0.0102
NP_441558.1_5 Forward -304 -285 9.24257 0.126
NP_441558.1_5 Reverse -184 -203 4.62101 0.276
NP_441942.1_7 Forward -246 -227 10.9142 0.282
NP_440209.1_1 Reverse -186 -194 8.57422 0.0425
NP_440209.1_1 Forward -195 -187 5.52596 0.0821
NP_440209.1_1 Reverse -369 -377 5.13263 0.17
NP_441713.1_1 Reverse -356 -375 -16.9135 0.289
NP_441713.1_3 Forward -387 -368 3.53937 0.259
NP_442111.1_4 Forward -196 -182 6.88276 0.11
NP_441387.1_7 Reverse -43 -62 5.99764 0.209
NP_440906.1_5 Reverse -187 -194 6.23397 0.234
NP_440906.1_5 Forward -194 -187 6.13563 0.241
NP_441486.1_1 Reverse -183 -197 -3.63866 0.18
NP_441695.1_4 Forward -376 -358 9.55725 0.294
NP_442848.1_4 Forward -224 -210 9.5377 0.282
NP_441012.1_4 Forward -306 -293 7.59077 0.272
NP_443018.1_3 Forward -194 -187 11.7405 0.0655
NP_443018.1_3 Reverse -187 -194 5.44732 0.193
NP_441634.1_8 Forward -373 -359 3.63784 0.145
NP_440376.1_1 Forward -378 -369 6.29291 0.104
NP_440376.1_1 Reverse -186 -195 5.99792 0.111
NP_440376.1_1 Reverse -362 -371 3.34298 0.206
NP_440376.1_1 Reverse -369 -378 -0.000272808 0.285
NP_440376.1_1 Forward -195 -186 -0.196935 0.285
NP_441588.1_4 Forward -376 -366 7.25653 0.178
NP_440266.1_2 Forward -295 -276 19.8623 0.0832
NP_442687.1_5 Reverse -197 -211 18.6629 0.244
NP_442687.1_7 Reverse -368 -378 14.3364 0.0329
NP_442687.1_7 Forward -196 -186 5.97822 0.179
NP_442687.1_7 Forward -303 -293 4.89658 0.23
NP_442687.1_7 Reverse -185 -195 4.50326 0.245
NP_440042.1_1 Forward -97 -78 21.5339 0.0222
NP_440042.1_8 Forward -33 -14 27.9255 0.000767
NP_440691.1_10 Forward -200 -181 9.83255 0.269
NP_442720.1_6 Forward -145 -126 10.7175 0.18
NP_442658.1_1 Reverse -184 -194 6.17443 0.235
NP_441414.1_9 Forward -195 -176 8.75091 0.0265
NP_441414.1_9 Reverse -186 -205 4.52268 0.0536
NP_441256.1_1 Forward -85 -66 -7.37537 0.239
NP_442937.1_5 Reverse -354 -373 8.65258 0.216
NP_441958.1_5 Forward -379 -369 1.65166 0.0872
NP_441958.1_5 Reverse -185 -195 0.865012 0.12
NP_441958.1_5 Forward -196 -186 0.865012 0.12
NP_441958.1_5 Forward -399 -389 -0.609952 0.215
NP_442816.1_7 Forward -163 -144 3.77151 0.287
NP_439905.1_1 Forward -194 -181 8.67241 0.232
NP_439905.1_1 Forward -370 -357 6.31247 0.293
NP_443001.1_4 Forward -257 -238 13.5691 0.153
NP_440984.1_7 Reverse -288 -302 4.71948 0.292
NP_442064.1_1 Forward -200 -181 -6.49039 0.221
NP_440993.1_2 Reverse -229 -245 1.23851 0.286
NP_442002.1_9 Reverse -185 -192 10.7572 0.185
NP_442002.1_9 Reverse -368 -375 9.08556 0.289
NP_441646.1_1 Reverse -362 -381 7.07928 0.164
NP_442438.1_10 Reverse -364 -378 -0.0987402 0.248
NP_440811.1_6 Reverse -74 -93 19.764 0.0746
NP_441000.1_6 Forward -196 -182 -3.73699 0.225
NP_442771.1_1 Forward -380 -362 -9.12563 0.216
NP_440147.1_4 Reverse -367 -380 9.45906 0.0401
NP_440147.1_4 Forward -400 -387 7.6891 0.064
NP_441175.1_7 Reverse -161 -180 5.89931 0.267
NP_441550.1_8 Forward -197 -187 13.0576 0.0273
NP_441550.1_8 Reverse -184 -194 4.7978 0.283
NP_441041.1_7 Forward -381 -369 12.4708 0.0611
NP_441041.1_7 Reverse -366 -378 5.37687 0.26
NP_441725.1_5 Forward -194 -184 1.455 0.135
NP_441725.1_5 Reverse -187 -197 0.0783647 0.215
NP_441725.1_5 Reverse -294 -304 -0.511621 0.26
NP_439966.1_7 Reverse -184 -194 8.73102 0.13
NP_439966.1_9 Reverse -184 -193 0.983037 0.253
NP_442941.1_3 Forward -194 -184 1.65166 0.147
NP_440289.1_2 Reverse -183 -196 3.65753 0.0754
NP_442281.1_1 Reverse -364 -378 6.39049 0.127
NP_442281.1_1 Forward -307 -293 2.35894 0.269
NP_442281.1_1 Forward -376 -362 1.5723 0.296
NP_441079.1_4 Forward -235 -216 15.1031 0.292
NP_441644.1_6 Forward -195 -185 7.15773 0.133
NP_441644.1_6 Reverse -369 -379 5.38779 0.194
NP_443049.1_6 Reverse -185 -195 11.6409 0.24
NP_442215.1_2 Reverse -360 -376 2.32015 0.117
NP_442029.1_6 Forward -127 -108 5.99764 0.246
NP_440929.1_8 Forward -195 -186 7.07956 0.0713
NP_440780.1_1 Forward -216 -197 10.8379 0.254
NP_442933.1_10 Reverse -369 -378 4.22796 0.267
NP_442554.1_8 Forward -194 -184 4.0116 0.2
NP_442554.1_8 Reverse -294 -304 2.92996 0.249
NP_442554.1_8 Reverse -363 -373 2.43831 0.272
NP_442554.1_8 Reverse -187 -197 2.33998 0.274
NP_441762.1_7 Reverse -185 -197 1.80894 0.0735
NP_441762.1_7 Forward -196 -184 -5.86088 0.246
NP_442142.1_4 Forward -381 -368 10.9334 0.0646
NP_442142.1_4 Forward -305 -292 2.96866 0.269
NP_442292.1_1 Forward -194 -185 -0.196935 0.239
NP_442292.1_5 Forward -382 -363 -1.37718 0.262
NP_440045.1_1 Reverse -35 -53 18.997 0.143
NP_440045.1_5 Reverse -105 -121 24.248 0.0114
NP_442476.1_6 Forward -194 -180 5.1128 0.139
NP_441711.1_4 Forward -387 -368 4.52268 0.21
NP_443009.1_5 Forward -379 -368 12.6445 0.0456
NP_441715.1_4 Forward -194 -184 6.46988 0.143
NP_440183.1_9 Reverse -355 -374 -12.5869 0.256
NP_440183.1_9 Reverse -295 -314 -14.4552 0.264
NP_441468.1_1 Reverse -187 -194 6.13563 0.209
NP_441468.1_1 Forward -194 -187 6.0373 0.223
NP_441673.1_1 Reverse -186 -195 1.37636 0.114
NP_441673.1_1 Forward -378 -369 1.27803 0.155
NP_441673.1_1 Reverse -369 -378 1.27803 0.155
NP_441673.1_1 Forward -195 -186 1.1797 0.163
NP_442868.1_6 Reverse -321 -331 2.14332 0.205
NP_442719.1_2 Reverse -163 -181 -4.2098 0.208
NP_441251.1_8 Forward -179 -166 13.3352 0.254
NP_441056.1_1 Forward -63 -44 -8.16202 0.282
NP_442427.1_8 Forward -204 -185 8.25926 0.203
NP_442808.1_1 Forward -196 -186 9.71433 0.0481
NP_442808.1_1 Reverse -329 -339 6.86274 0.0941
NP_442808.1_1 Reverse -279 -289 4.20782 0.203
NP_442808.1_1 Reverse -361 -371 3.61784 0.234
NP_441101.1_5 Forward -33 -15 15.727 0.246
NP_440558.1_2 Forward -375 -356 1.0811 0.185
NP_441518.1_3 Reverse -117 -136 -15.4385 0.293
NP_441878.1_6 Forward -303 -293 0.57002 0.14
NP_441878.1_6 Forward -196 -186 0.57002 0.14
NP_441878.1_6 Forward -379 -369 -7.49312 0.231
NP_441036.1_8 Reverse -185 -195 6.8632 0.213
NP_441036.1_8 Reverse -361 -371 5.87989 0.253
NP_442650.1_2 Forward -63 -49 11.111 0.13
NP_441557.1_5 Reverse -186 -195 1.08137 0.0794
NP_441557.1_5 Forward -195 -186 0.589713 0.134
NP_441557.1_5 Forward -378 -369 0.393051 0.166
NP_441557.1_5 Reverse -369 -378 0.393051 0.166
NP_442066.2_9 Forward -382 -369 7.6891 0.212
NP_441308.1_8 Reverse -184 -194 8.4365 0.254
NP_442397.1_9 Reverse -94 -113 2.55606 0.273
NP_442347.1_2 Forward -194 -185 8.94785 0.0718
NP_442888.1_6 Reverse -282 -301 12.5858 0.148
NP_440563.1_2 Reverse -134 -151 18.9184 0.102
NP_441633.1_3 Reverse -367 -380 2.37923 0.0969
NP_440136.1_2 Reverse -187 -194 6.23397 0.171
NP_440136.1_2 Forward -194 -187 6.13563 0.193
NP_442998.1_5 Reverse -218 -228 13.353 0.158
NP_442998.1_5 Reverse -193 -203 11.3864 0.187
NP_442998.1_10 Forward -193 -186 15.5754 0.0102
NP_442998.1_10 Forward -376 -369 12.5271 0.0457
NP_441799.1_1 Forward -199 -185 12.3887 0.0441
NP_441007.1_10 Forward -383 -370 2.67422 0.183
NP_442334.1_2 Reverse -359 -376 -4.18939 0.2
NP_441435.1_9 Forward -382 -363 18.4848 0.29
NP_442961.1_4 Forward -102 -83 3.73603 0.288
NP_440915.1_6 Reverse -182 -196 1.96621 0.128
NP_440915.1_6 Reverse -365 -379 -3.24533 0.292
NP_440915.1_6 Forward -247 -233 -3.24533 0.292
NP_441179.1_2 Reverse -44 -63 19.9606 0.000282
NP_441179.1_4 Reverse -107 -126 16.9115 0.0786
NP_440134.1_2 Reverse -184 -203 1.37609 0.298
NP_442866.1_1 Reverse -288 -307 -8.35868 0.279
NP_441494.1_6 Forward -59 -46 5.72248 0.294
NP_442993.1_1 Forward -378 -362 -8.59459 0.17
NP_440677.1_1 Reverse -237 -256 8.06259 0.218
NP_442386.1_9 Reverse -185 -194 5.9975 0.23
NP_442386.1_9 Forward -372 -363 5.21086 0.262
NP_442386.1_9 Forward -196 -187 4.52254 0.297
NP_442054.1_3 Reverse -225 -244 -5.99873 0.297
NP_441340.1_5 Reverse -187 -194 13.5105 0.0314
NP_441340.1_5 Forward -194 -187 5.84064 0.208
NP_440161.1_3 Reverse -291 -310 11.4058 0.217
NP_440586.1_8 Forward -194 -187 9.47853 0.146
NP_440586.1_8 Forward -301 -294 5.8403 0.283
NP_440586.1_8 Reverse -187 -194 5.74197 0.283
NP_442251.1_6 Forward -377 -370 8.69224 0.199
NP_440684.1_9 Reverse -363 -377 7.57108 0.261
NP_441262.1_3 Reverse -186 -193 14.7888 0.0223
NP_440027.1_3 Forward -378 -360 6.70489 0.223
NP_443051.1_1 Reverse -185 -194 7.47288 0.0571
NP_443051.1_1 Forward -379 -370 -0.000272808 0.245
NP_443051.1_1 Forward -196 -187 -1.18024 0.297
NP_439937.1_9 Forward -372 -355 -16.5797 0.287
NP_440408.1_3 Forward -261 -242 -5.50708 0.289
NP_440439.1_1 Reverse -359 -372 0.805932 0.175
NP_440439.1_1 Reverse -183 -196 -0.177378 0.209
NP_440372.1_2 Reverse -187 -194 13.8055 0.0214
NP_440372.1_2 Forward -194 -187 6.52896 0.188
NP_440271.1_2 Forward -311 -292 3.04771 0.28
NP_441138.1_6 Forward -280 -261 13.9625 0.255
NP_440819.1_5 Reverse -192 -200 7.8859 0.266
NP_440316.1_10 Reverse -185 -195 11.1898 0.214
NP_442663.1_1 Reverse -143 -162 7.86512 0.193
NP_440139.1_1 Reverse -180 -199 8.75009 0.109
NP_442549.1_3 Forward -382 -363 6.78429 0.298
NP_442384.1_10 Forward -371 -358 3.46087 0.19
NP_442384.1_10 Reverse -73 -86 3.26421 0.197
NP_442384.1_10 Forward -195 -182 2.08423 0.237
NP_441380.1_8 Reverse -284 -303 6.09597 0.222
NP_440364.1_6 Reverse -66 -79 15.26 0.275
NP_442790.1_4 Reverse -360 -379 -14.5535 0.278
NP_442262.1_10 Forward -194 -187 13.2155 0.0213
NP_441689.1_5 Reverse -184 -194 5.97777 0.197
NP_440163.1_10 Reverse -183 -193 14.238 0.102
NP_440163.1_10 Forward -305 -295 8.82982 0.26
NP_440344.1_10 Reverse -355 -372 -12.8425 0.267
NP_440282.1_10 Reverse -69 -88 -10.3253 0.297
NP_440531.1_6 Forward -386 -367 -1.08219 0.227
NP_440297.1_9 Reverse -294 -304 9.32148 0.0917
NP_440297.1_9 Forward -194 -184 -0.511621 0.289
NP_441103.1_1 Forward -176 -157 9.0459 0.253
NP_440894.1_10 Reverse -229 -248 10.5209 0.155
NP_440999.1_1 Reverse -56 -75 12.9783 0.084
NP_440999.1_9 Reverse -365 -379 0.0979218 0.193
NP_440999.1_9 Reverse -358 -372 -1.08205 0.226
NP_440999.1_9 Forward -372 -358 -1.77037 0.249
NP_440999.1_9 Reverse -230 -244 -2.45868 0.27
NP_440888.1_2 Forward -195 -181 12.6836 0.0405
NP_440491.1_1 Forward -246 -227 8.18396 0.249
NP_440491.1_1 Reverse -320 -339 7.69667 0.261
NP_439969.1_3 Reverse -170 -189 -1.67217 0.282
NP_441123.1_6 Reverse -211 -229 12.3105 0.14
NP_441543.1_2 Forward -194 -185 8.65285 0.0968
NP_442845.1_2 Reverse -180 -194 7.76774 0.195
NP_442845.1_2 Reverse -287 -301 4.42448 0.259
NP_440739.1_3 Forward -192 -173 8.16093 0.281
NP_442710.1_7 Forward -140 -121 -8.66439 0.299
NP_441469.1_8 Reverse -185 -194 6.39124 0.227
NP_443064.1_6 Forward -398 -388 14.4091 0.0796
NP_443064.1_6 Reverse -100 -110 8.59164 0.278
NP_442337.1_8 Reverse -352 -371 16.2241 0.0923
NP_442578.1_7 Reverse -187 -194 6.0373 0.18
NP_441462.1_2 Reverse -186 -196 16.1063 0.00406
NP_441462.1_2 Reverse -369 -379 1.06167 0.103
NP_443062.1_1 Forward -195 -177 3.86557 0.282
NP_441410.1_3 Forward -279 -260 6.68596 0.23
NP_442204.1_5 Reverse -359 -378 10.9142 0.0859
NP_440544.1_5 Reverse -273 -280 14.5681 0.264
NP_440516.1_8 Reverse -186 -195 18.9776 0.00442
NP_440516.1_8 Reverse -369 -378 5.89959 0.103
NP_440516.1_8 Forward -195 -186 5.01461 0.118
NP_442428.1_5 Reverse -187 -194 6.13563 0.209
NP_442428.1_5 Forward -194 -187 6.0373 0.212
NP_442120.1_10 Reverse -363 -382 -14.3569 0.288
NP_440673.1_3 Forward -193 -186 12.4288 0.0426
NP_440673.1_3 Forward -376 -369 9.77388 0.167
NP_441052.1_2 Forward -195 -185 1.25834 0.249
NP_441052.1_2 Forward -136 -126 0.471689 0.257
NP_440436.1_4 Forward -377 -368 11.7007 0.0483
NP_440436.1_4 Forward -194 -185 8.55409 0.0997
NP_441884.1_9 Reverse -366 -385 -25.9599 0.29
NP_440648.1_1 Reverse -186 -205 7.96426 0.189
NP_441719.1_4 Reverse -187 -194 6.82395 0.0855
NP_441719.1_4 Forward -194 -187 6.52896 0.188
NP_441733.1_10 Reverse -183 -196 6.4108 0.188
NP_441004.1_1 Forward -74 -55 -15.5368 0.275
NP_442366.1_3 Forward -379 -361 -3.32411 0.246
NP_442694.1_4 Forward -231 -222 15.4377 0.164
NP_443054.1_2 Forward -380 -366 0.88457 0.252
NP_443054.1_2 Forward -373 -359 -0.295402 0.293
NP_441668.1_4 Forward -312 -293 -1.08219 0.267
NP_441668.1_4 Reverse -349 -368 -2.0655 0.286
NP_440463.1_8 Forward -232 -213 5.56364 0.277
NP_440165.1_5 Reverse -368 -387 -0.000545616 0.156
NP_442450.1_5 Forward -197 -187 8.23984 0.13
NP_440588.1_2 Reverse -177 -196 -2.26216 0.163
NP_441078.1_4 Forward -371 -362 5.01461 0.122
NP_441078.1_4 Reverse -369 -378 0.589713 0.174
NP_441078.1_4 Forward -378 -369 0.589713 0.174
NP_441078.1_4 Reverse -186 -195 0.196389 0.205
NP_441078.1_4 Forward -195 -186 -0.000272808 0.205
NP_442729.1_5 Forward -303 -293 8.4365 0.248
NP_440526.1_3 Reverse -370 -381 8.21964 0.126
NP_441432.1_8 Reverse -185 -194 5.50626 0.151
NP_442320.1_4 Reverse -282 -301 17.0099 0.266
NP_442320.1_8 Reverse -180 -194 4.42448 0.0504
NP_442344.1_7 Forward -377 -358 -8.55534 0.218
NP_440760.1_1 Reverse -186 -205 -21.3384 0.234
NP_441131.1_10 Reverse -348 -367 15.8307 0.142
NP_441072.1_2 Forward -382 -363 8.06259 0.24
NP_442489.1_2 Reverse -269 -288 2.85105 0.254
NP_442489.1_7 Forward -378 -369 8.06287 0.0371
NP_442489.1_7 Forward -195 -186 0.688044 0.152
NP_442489.1_7 Reverse -186 -195 0.688044 0.152
NP_442489.1_7 Reverse -369 -378 0.589713 0.17
NP_442489.1_7 Forward -371 -362 -1.57357 0.213
NP_442489.1_7 Forward -398 -389 -2.16355 0.295
NP_441706.1_10 Reverse -356 -375 9.14423 0.245
NP_440559.1_1 Reverse -187 -196 6.39124 0.134
NP_441659.2_8 Reverse -369 -379 8.1415 0.0477
NP_441659.2_8 Reverse -186 -196 0.275027 0.27
NP_442913.1_9 Forward -51 -32 9.63589 0.22
NP_442913.1_10 Forward -387 -368 -4.72043 0.244
NP_441040.1_2 Forward -238 -219 -16.3235 0.295
NP_442849.1_1 Forward -282 -268 12.4876 0.201
NP_442346.1_5 Forward -303 -293 14.1397 0.0164
NP_442346.1_5 Reverse -368 -378 4.89658 0.269
NP_442346.1_5 Forward -196 -186 4.3066 0.291
NP_441923.1_8 Forward -34 -20 19.0758 0.138
NP_440486.1_6 Forward -83 -64 12.5858 0.207
NP_440459.1_2 Forward -197 -180 8.20031 0.267
NP_440459.1_2 Reverse -360 -377 7.31533 0.296
NP_440010.1_10 Reverse -61 -80 7.57094 0.226
NP_441943.1_5 Reverse -186 -205 16.7531 0.189
NP_442137.1_5 Reverse -342 -356 18.9775 0.216
NP_442603.1_7 Reverse -186 -200 8.55376 0.171
NP_442603.1_7 Forward -82 -68 8.25877 0.178
NP_442603.1_7 Forward -398 -384 7.47213 0.205
NP_441585.1_5 Reverse -226 -245 0.392004 0.291
NP_441833.1_4 Forward -194 -187 6.52896 0.0924
NP_441833.1_4 Reverse -187 -194 6.23397 0.163
NP_442799.1_2 Forward -373 -354 7.37428 0.166
NP_441895.1_10 Reverse -189 -208 -18.8801 0.282
NP_442162.1_9 Forward -194 -187 12.9205 0.0282
NP_442162.1_9 Reverse -187 -194 12.9205 0.0282
NP_442796.1_2 Reverse -325 -344 16.709 0.199
NP_442404.1_9 Forward -368 -354 11.5037 0.263
NP_442546.1_2 Reverse -258 -277 7.17681 0.141
NP_442199.1_4 Forward -329 -310 9.24257 0.169
NP_442140.1_1 Reverse -271 -290 15.0882 0.201
NP_442140.1_3 Forward -194 -184 6.27322 0.176
NP_442140.1_3 Reverse -187 -197 6.07655 0.184
NP_442140.1_3 Forward -370 -360 4.60159 0.242
NP_440875.1_9 Forward -369 -359 11.2921 0.175
NP_441813.1_5 Reverse -184 -194 7.45319 0.0746
NP_441813.1_5 Forward -197 -187 5.68323 0.113
NP_442254.1_1 Forward -314 -295 -4.72043 0.282
NP_442089.1_1 Forward -398 -379 -0.295539 0.261
NP_440590.1_4 Forward -377 -364 7.19745 0.0544
NP_440590.1_4 Forward -397 -384 1.59258 0.118
NP_440590.1_4 Reverse -363 -376 -2.144 0.237
NP_440567.1_1 Forward -194 -180 4.81781 0.111
NP_442497.1_10 Reverse -187 -196 1.08137 0.115
NP_442497.1_10 Forward -194 -185 0.589713 0.153
NP_440821.1_4 Reverse -184 -194 9.32148 0.03
NP_441239.1_9 Forward -197 -185 11.7404 0.0551
NP_441239.1_9 Reverse -291 -303 7.70879 0.15
NP_441239.1_9 Reverse -360 -372 3.08724 0.296
NP_440156.1_4 Forward -204 -194 13.9425 0.176
NP_440624.1_5 Forward -213 -195 14.6086 0.16
NP_440665.1_1 Forward -82 -63 -10.6203 0.244
NP_440863.1_1 Forward -280 -266 19.7112 0.0788
NP_440900.1_9 Reverse -282 -301 14.2574 0.222
NP_440212.1_5 Forward -200 -181 15.1424 0.218
NP_440354.1_7 Reverse -180 -198 9.45892 0.224
NP_440546.1_4 Reverse -186 -196 14.9908 0.0459
NP_440546.1_4 Forward -302 -292 10.9186 0.101
NP_440546.1_4 Forward -195 -185 6.55553 0.291
NP_441603.1_5 Reverse -265 -284 12.29 0.277
NP_440462.1_6 Reverse -184 -194 5.87989 0.135
NP_440462.1_6 Forward -272 -262 2.14332 0.294
NP_440868.1_4 Reverse -182 -194 8.10212 0.0602
NP_440868.1_4 Reverse -358 -370 -0.551008 0.274
NP_442499.1_4 Reverse -314 -328 15.4376 0.226
NP_442479.1_8 Forward -258 -239 6.4893 0.248
NP_440812.1_10 Reverse -75 -88 15.8506 0.259
NP_442402.1_2 Reverse -270 -284 11.7987 0.272
NP_442402.1_4 Reverse -265 -284 4.12856 0.147
NP_441848.1_7 Reverse -266 -285 0.785326 0.228
NP_441848.1_7 Reverse -267 -286 -3.93454 0.286
NP_441084.1_6 Forward -380 -366 10.0228 0.255
NP_441843.2_9 Forward -369 -351 10.492 0.231
NP_442923.1_4 Reverse -363 -382 -5.11376 0.263
NP_442039.1_4 Reverse -187 -194 11.6422 0.0747
NP_441926.1_3 Reverse -261 -277 2.51681 0.269
NP_442837.1_3 Forward -194 -187 6.0373 0.25
NP_442837.1_3 Reverse -187 -194 6.0373 0.25
NP_442053.1_1 Forward -195 -186 14.4544 0.0114
NP_442053.1_1 Reverse -186 -195 7.86621 0.0863
NP_440505.1_3 Reverse -184 -194 12.2714 0.0543
NP_442360.1_5 Forward -288 -278 15.123 0.172
NP_441102.1_1 Forward -81 -62 4.22769 0.272
NP_442456.1_5 Reverse -182 -200 6.214 0.275
NP_441011.1_8 Reverse -187 -196 9.24284 0.131
NP_441011.1_8 Forward -194 -185 7.07956 0.179
NP_442533.1_6 Forward -371 -362 12.5861 0.0277
NP_442533.1_6 Forward -302 -293 4.62128 0.179
NP_442533.1_6 Forward -195 -186 4.42462 0.179
NP_442541.1_10 Forward -372 -358 4.22722 0.252
NP_442229.1_1 Forward -380 -366 7.57046 0.196
NP_441482.1_7 Forward -308 -294 -11.9968 0.288
NP_439944.1_9 Reverse -370 -380 6.27322 0.188
NP_441697.1_5 Reverse -121 -140 -9.59736 0.271
NP_441527.1_4 Forward -276 -257 4.53544 0.111
NP_441527.1_4 Reverse -144 -163 3.29405 0.118
NP_441527.1_4 Forward -274 -255 -6.25514 0.215
NP_441527.1_4 Forward -275 -256 -9.88384 0.262
NP_441106.1_1 Reverse -185 -194 8.45619 0.0548
NP_441106.1_1 Forward -379 -370 5.50626 0.145
NP_439903.1_6 Forward -381 -362 10.6184 0.103
NP_441186.1_5 Reverse -144 -163 16.7584 0.193
NP_441286.1_1 Reverse -185 -197 -4.48425 0.161
NP_440670.1_8 Forward -378 -369 13.2744 0.0157
NP_440670.1_8 Reverse -186 -195 8.75118 0.0606
NP_440670.1_8 Forward -195 -186 6.19458 0.124
NP_440103.1_3 Forward -160 -150 15.4857 0.286
NP_440886.1_7 Reverse -368 -378 11.2876 0.0805
NP_440886.1_7 Reverse -185 -195 6.86274 0.113
NP_440886.1_7 Forward -196 -186 6.76441 0.114
NP_440886.1_7 Reverse -60 -70 4.60114 0.227
NP_442614.1_2 Reverse -186 -200 10.226 0.234
NP_442614.1_2 Reverse -362 -376 6.88276 0.28
NP_439995.1_5 Reverse -176 -195 4.32602 0.286
NP_442072.1_9 Forward -303 -285 -11.1906 0.0789
NP_442072.1_9 Forward -244 -226 -13.5505 0.115
NP_440907.2_8 Forward -194 -184 6.0761 0.179
NP_440907.2_8 Forward -370 -360 4.99446 0.228
NP_440030.1_10 Reverse -168 -187 4.62101 0.276
NP_441463.1_3 Reverse -251 -270 -9.047 0.276
NP_441626.1_2 Reverse -187 -194 12.2322 0.0511
NP_441626.1_2 Forward -194 -187 5.93897 0.231
NP_441460.1_2 Forward -224 -211 13.195 0.289
NP_442794.1_1 Reverse -69 -81 3.18557 0.286
NP_442615.1_1 Forward -380 -362 -6.56903 0.252
NP_441962.1_4 Reverse -364 -383 -9.53865 0.218
NP_441962.1_4 Forward -62 -43 -12.8819 0.265
NP_440387.1_1 Forward -378 -362 -2.5964 0.148
NP_440387.1_1 Reverse -369 -385 -2.89139 0.152
NP_441431.1_2 Reverse -327 -341 7.57046 0.238
NP_441431.1_2 Reverse -359 -373 6.39049 0.272
NP_440634.1_2 Reverse -61 -80 16.4207 0.286
NP_440814.1_8 Forward -281 -262 1.27776 0.269
NP_440114.1_10 Reverse -186 -200 8.65272 0.198
NP_440114.1_10 Reverse -369 -383 7.07942 0.246
NP_440114.1_10 Forward -195 -181 7.07942 0.246
NP_440287.1_5 Reverse -261 -280 7.37347 0.286
NP_442087.1_2 Reverse -186 -205 14.5672 0.216
NP_440293.1_3 Forward -69 -50 -5.01543 0.269
NP_440766.1_4 Reverse -182 -196 1.47456 0.23
NP_441237.1_9 Reverse -187 -197 14.0414 0.0535
NP_441237.1_9 Reverse -363 -373 11.0914 0.2
NP_440457.1_1 Reverse -182 -194 2.20226 0.216
NP_441981.1_3 Forward -282 -268 15.1853 0.268
NP_441801.1_4 Reverse -238 -248 3.32329 0.231
NP_442680.1_5 Forward -283 -264 9.84127 0.134
NP_442680.1_5 Forward -282 -263 6.32442 0.207
NP_442297.1_4 Forward -274 -255 11.4598 0.3
NP_441984.1_3 Reverse -217 -235 9.65558 0.204
NP_440473.1_9 Forward -389 -370 0.196116 0.127
NP_442509.1_9 Reverse -186 -196 13.1559 0.061
NP_442509.1_9 Forward -195 -185 9.71433 0.192
NP_442509.1_9 Reverse -322 -332 7.64939 0.21
NP_442509.1_9 Forward -378 -368 6.27276 0.279
NP_442514.1_5 Forward -90 -71 -8.94939 0.292
NP_440554.1_4 Forward -194 -184 11.6814 0.0377
NP_441885.1_5 Reverse -186 -196 -0.0199663 0.186
NP_441885.1_5 Reverse -362 -372 -0.314959 0.195
NP_441885.1_5 Forward -398 -388 -0.609952 0.215
NP_442341.1_5 Forward -370 -351 10.6192 0.297
NP_442341.1_7 Forward -83 -69 10.9143 0.0591
NP_442341.1_7 Forward -399 -385 8.84938 0.0822
NP_442341.1_7 Forward -196 -182 3.24451 0.23
NP_442341.1_7 Reverse -361 -375 3.04785 0.237
NP_442341.1_9 Reverse -184 -198 8.3571 0.171
NP_442341.1_9 Reverse -360 -374 7.07881 0.204
NP_441173.1_9 Forward -146 -138 10.6388 0.261
NP_442534.1_7 Reverse -361 -380 9.14423 0.225
NP_441842.1_1 Forward -369 -356 16.1449 0.0484
NP_441842.1_10 Forward -250 -236 6.29277 0.296
NP_440275.1_3 Forward -380 -370 5.97822 0.129
NP_440275.1_3 Reverse -184 -194 5.87989 0.13
NP_442275.1_1 Forward -371 -352 1.96607 0.284
NP_441397.1_8 Forward -284 -271 13.2397 0.245
NP_441902.1_3 Forward -284 -274 15.9942 0.163
NP_440804.1_7 Forward -158 -141 8.98622 0.261
NP_440216.1_1 Forward -195 -181 -4.81863 0.115
NP_440172.1_1 Reverse -186 -196 7.55152 0.0761
NP_440172.1_1 Reverse -369 -379 4.50326 0.184
NP_442418.1_4 Forward -215 -197 15.4717 0.215
NP_442015.1_10 Reverse -69 -82 1.69091 0.204
NP_442015.1_10 Reverse -365 -378 -0.964025 0.289
NP_441226.1_7 Reverse -187 -194 12.7234 0.0312
NP_441226.1_7 Forward -194 -187 11.5435 0.0757
NP_441111.1_7 Forward -194 -186 8.86921 0.0589
NP_442379.1_9 Reverse -368 -382 17.8958 0.221
NP_441766.1_2 Forward -195 -186 14.7494 0.00772
NP_442417.1_5 Forward -195 -181 9.93102 0.124
NP_440416.1_1 Reverse -369 -388 -9.83364 0.272
NP_442116.1_2 Reverse -151 -170 11.3067 0.289
NP_441940.1_4 Reverse -46 -65 6.19431 0.294
NP_442154.1_1 Forward -244 -226 -19.2537 0.294
NP_440261.1_5 Forward -370 -357 -6.86388 0.201
NP_440261.1_5 Forward -194 -181 -10.7971 0.21
NP_440261.1_5 Reverse -187 -200 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGTCGATCAGCACCGCATAGAGACGATTGCCGATGCCCGCCAAAGTAAATTCCAATTCTACGCTTTCGGGGGTTTCCACCTGATAATGGTTAAACAGGGCCATGGTTTCTAGCTTTGGGGGAGAAAAAAGGGGATAGAGACAATGATGGTTCCAGGGGAGATTAGCTCGGGCGTTTTGTCCCTGAGGCAAGCTTTAAAATTTTGCCCGATCGCCGTAAGATAAAGGCTGGCAAAGCTTGTTTTTATTGGCGTATTTAACAAAAGACTATGGACATTTTGACATTAGGTTGGGTAAGCGTGTTAGTTCTGTTCACCTGGTCCATCAGCATGGTGGTATGGGGTCGGAACGGCTTCTAGGATTAAACCTGGATTTCCCGTTGTTTAAGAGTCTTTGATACC

CDS

GTGGAAGCAACTCCTACTCCTGTCCTCAACACCCTTTTTTTAGCGGCCCTGGTGATGCTAGTGCTTGTTAGTGGTGGCATTCTCTACCTCACCACCCTGGAATGGCGCGATCGCCGTCGGCAGGATCGGGATAAAAAAATGGGTCGCTAG

Protein

MEATPTPVLNTLFLAALVMLVLVSGGILYLTTLEWRDRRRQDRDKKMGR