Your browser is old and dusty. Try Google Chrome!

Details for sgl0001

ORF sgl0001
Accession NP_442424.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -213 -199 1.17956 0.193
NP_441061.1_2 Reverse -333 -347 -0.393733 0.228
NP_441061.1_2 Reverse -212 -226 -0.393733 0.228
NP_441061.1_3 Reverse -208 -227 16.1249 0.181
NP_440795.1_7 Reverse -246 -253 6.92228 0.26
NP_441453.1_4 Forward -214 -206 6.80426 0.121
NP_441453.1_4 Reverse -205 -213 6.11594 0.121
NP_441453.1_4 Forward -341 -333 3.85433 0.284
NP_442151.1_6 Reverse -205 -219 10.6193 0.119
NP_442151.1_6 Forward -341 -327 5.1128 0.294
NP_441818.1_9 Forward -355 -336 -5.99873 0.258
NP_441818.1_9 Forward -45 -26 -10.817 0.299
NP_441465.1_8 Reverse -201 -219 8.27895 0.235
NP_442623.1_3 Reverse -206 -225 -9.44032 0.141
NP_442173.1_1 Reverse -206 -214 12.0158 0.0316
NP_442173.1_1 Forward -213 -205 4.83764 0.241
NP_442752.1_4 Forward -214 -207 13.8055 0.0199
NP_441745.1_3 Reverse -349 -368 16.4199 0.211
NP_442975.1_10 Forward -351 -337 4.42388 0.245
NP_440784.1_7 Forward -213 -206 6.23397 0.241
NP_440784.1_7 Reverse -206 -213 6.13563 0.241
NP_440061.1_9 Reverse -330 -344 5.89884 0.266
NP_441054.1_2 Forward -358 -339 14.4541 0.166
NP_442074.1_5 Reverse -358 -377 15.6341 0.237
NP_442062.1_8 Forward -341 -331 3.32329 0.275
NP_439918.1_2 Reverse -283 -302 -5.11376 0.298
NP_442742.1_9 Reverse -21 -40 4.32602 0.127
NP_441925.1_4 Reverse -338 -357 -17.4058 0.294
NP_441083.1_5 Reverse -205 -215 17.7779 0.00336
NP_441083.1_5 Forward -214 -204 7.05986 0.067
NP_441083.1_5 Reverse -332 -342 -0.0199663 0.251
NP_441738.1_2 Reverse -207 -214 15.28 0.0102
NP_441738.1_4 Forward -224 -205 9.73422 0.172
NP_441558.1_5 Reverse -330 -349 4.81767 0.269
NP_440209.1_1 Forward -214 -206 8.57422 0.0425
NP_440209.1_1 Reverse -205 -213 5.52596 0.0821
NP_440209.1_1 Reverse -332 -340 2.1827 0.254
NP_442889.1_8 Reverse -202 -216 7.3738 0.152
NP_440178.1_7 Reverse -204 -223 -14.3569 0.153
NP_441792.1_6 Forward -174 -156 11.1298 0.26
NP_441716.1_1 Forward -347 -333 3.44117 0.265
NP_441716.1_1 Forward -30 -16 2.75286 0.294
NP_441327.1_3 Reverse -266 -285 15.1416 0.202
NP_440906.1_5 Forward -213 -206 6.23397 0.234
NP_440906.1_5 Reverse -206 -213 6.13563 0.241
NP_440747.1_10 Reverse -18 -30 -2.91095 0.0732
NP_440747.1_10 Forward -217 -205 -4.48425 0.101
NP_441130.1_10 Reverse -203 -217 5.70279 0.218
NP_441486.1_1 Forward -217 -203 -2.85201 0.175
NP_440842.1_10 Reverse -202 -216 2.2612 0.277
NP_442848.1_1 Forward -220 -206 -2.16369 0.263
NP_442848.1_5 Reverse -337 -355 3.06741 0.276
NP_442848.1_9 Forward -220 -201 1.57275 0.258
NP_443018.1_3 Reverse -206 -213 11.7405 0.0655
NP_443018.1_3 Forward -340 -333 11.3472 0.0846
NP_443018.1_3 Forward -213 -206 5.44732 0.193
NP_443018.1_3 Reverse -333 -340 4.16902 0.278
NP_441634.1_8 Forward -143 -129 11.3077 0.0624
NP_441634.1_8 Forward -256 -242 -2.65535 0.295
NP_441634.1_8 Forward -216 -202 -4.4253 0.295
NP_440376.1_1 Forward -214 -205 5.99792 0.111
NP_440376.1_1 Forward -30 -21 5.3096 0.137
NP_440376.1_1 Reverse -205 -214 -0.196935 0.285
NP_441588.1_4 Reverse -207 -217 18.1713 0.0143
NP_441588.1_4 Reverse -334 -344 5.38824 0.272
NP_442687.1_7 Reverse -204 -214 5.97822 0.179
NP_442687.1_7 Forward -387 -377 3.61828 0.299
NP_441846.1_10 Forward -365 -346 -12.1936 0.19
NP_442088.1_9 Reverse -129 -148 13.6675 0.284
NP_441950.1_7 Forward -359 -340 -2.65548 0.201
NP_440360.1_10 Reverse -334 -348 3.73617 0.227
NP_442658.1_1 Reverse -203 -213 5.87944 0.246
NP_442198.1_3 Reverse -368 -387 2.26107 0.299
NP_442782.1_2 Forward -353 -339 7.86607 0.202
NP_442782.1_2 Forward -352 -338 2.94952 0.269
NP_441414.1_9 Forward -214 -195 -7.27704 0.214
NP_441414.1_9 Reverse -63 -82 -7.4737 0.219
NP_441414.1_9 Reverse -205 -224 -9.14533 0.254
NP_441958.1_5 Reverse -204 -214 0.865012 0.12
NP_441958.1_5 Forward -215 -205 0.865012 0.12
NP_441127.1_1 Forward -350 -336 12.1926 0.215
NP_442486.1_3 Reverse -358 -376 17.2271 0.12
NP_442836.1_5 Reverse -199 -218 0.687771 0.299
NP_440203.1_5 Forward -257 -247 9.02601 0.275
NP_442690.1_1 Reverse -105 -124 -10.3253 0.212
NP_440153.1_8 Reverse -344 -357 6.1158 0.175
NP_440858.1_1 Forward -197 -178 3.14605 0.13
NP_443055.1_6 Reverse -251 -269 3.36165 0.196
NP_443055.1_6 Reverse -197 -215 1.10005 0.237
NP_443055.1_6 Forward -214 -196 0.0184138 0.251
NP_440993.1_3 Reverse -367 -386 -0.591301 0.272
NP_441099.1_5 Reverse -195 -214 8.06259 0.04
NP_442438.1_10 Reverse -293 -307 5.1128 0.139
NP_442438.1_10 Forward -355 -341 1.08123 0.206
NP_442431.1_2 Forward -187 -168 21.0423 0.0726
NP_440879.1_6 Reverse -200 -219 -3.3438 0.279
NP_441000.1_6 Reverse -204 -218 -4.52363 0.245
NP_440147.1_4 Forward -216 -203 9.95071 0.0362
NP_441550.1_8 Reverse -203 -213 15.2208 0.0132
NP_441550.1_8 Forward -216 -206 13.3526 0.0252
NP_441041.1_4 Reverse -205 -224 -6.58872 0.169
NP_441041.1_7 Reverse -202 -214 9.55551 0.109
NP_441041.1_7 Forward -217 -205 7.32042 0.169
NP_441547.1_1 Forward -218 -199 5.50599 0.226
NP_441547.1_2 Reverse -52 -70 4.34571 0.249
NP_442004.1_6 Reverse -332 -346 3.34284 0.242
NP_441725.1_4 Reverse -16 -30 7.96378 0.215
NP_441725.1_5 Forward -213 -203 7.05986 0.106
NP_439966.1_7 Reverse -203 -213 7.84605 0.149
NP_439966.1_7 Reverse -330 -340 4.50281 0.269
NP_442941.1_3 Forward -29 -19 4.69992 0.14
NP_442941.1_3 Reverse -206 -216 1.25834 0.15
NP_440289.1_2 Reverse -202 -215 10.7374 0.0239
NP_440289.1_2 Forward -217 -204 -3.61896 0.267
NP_440983.1_5 Reverse -335 -354 2.3594 0.199
NP_441678.1_9 Reverse -283 -302 -5.01543 0.297
NP_442281.1_1 Reverse -200 -214 8.3571 0.0823
NP_442281.1_1 Forward -210 -196 4.03056 0.21
NP_442256.1_2 Reverse -203 -221 0.412472 0.122
NP_442500.1_2 Forward -355 -336 8.65258 0.283
NP_441644.1_6 Reverse -205 -215 14.4342 0.0126
NP_441644.1_6 Reverse -298 -308 6.46942 0.157
NP_441644.1_6 Reverse -332 -342 4.10949 0.249
NP_443049.1_6 Forward -215 -205 14.4711 0.114
NP_442215.1_2 Reverse -203 -219 -4.36636 0.232
NP_442215.1_2 Forward -33 -17 -6.7263 0.278
NP_442215.1_2 Forward -343 -327 -7.61128 0.3
NP_440253.1_2 Reverse -72 -90 7.19731 0.0735
NP_440929.1_8 Reverse -205 -214 7.07956 0.0713
NP_440780.1_1 Reverse -165 -184 8.45061 0.274
NP_441751.2_8 Forward -213 -199 0.982901 0.109
NP_441751.2_8 Reverse -333 -347 0.687908 0.113
NP_441751.2_8 Reverse -197 -211 -6.49025 0.269
NP_442554.1_8 Reverse -333 -343 7.15819 0.0975
NP_442554.1_8 Reverse -206 -216 5.48657 0.146
NP_442554.1_8 Forward -213 -203 5.09324 0.161
NP_442554.1_8 Reverse -197 -207 2.83163 0.253
NP_441762.1_7 Forward -215 -203 -5.07423 0.187
NP_441762.1_7 Forward -304 -292 -6.5492 0.284
NP_442142.1_4 Reverse -329 -342 7.00021 0.151
NP_442142.1_4 Reverse -202 -215 6.0169 0.175
NP_442292.1_1 Reverse -206 -215 8.65285 0.0335
NP_442301.1_2 Reverse -337 -356 4.81688 0.272
NP_441715.1_4 Forward -395 -385 5.48657 0.2
NP_440357.1_3 Reverse -194 -213 0.687771 0.28
NP_440183.1_9 Forward -219 -200 -11.4069 0.251
NP_441198.1_5 Reverse -207 -220 13.9817 0.206
NP_440379.1_5 Forward -356 -337 -11.1119 0.288
NP_440464.1_10 Reverse -147 -157 11.9577 0.273
NP_441468.1_1 Forward -213 -206 6.13563 0.209
NP_441468.1_1 Reverse -206 -213 6.0373 0.223
NP_441468.1_1 Reverse -333 -340 3.97235 0.277
NP_441015.1_10 Forward -352 -333 3.44104 0.136
NP_441015.1_10 Forward -346 -327 -11.5053 0.298
NP_441673.1_1 Forward -214 -205 1.37636 0.114
NP_441673.1_1 Reverse -205 -214 1.1797 0.163
NP_441731.1_3 Forward -222 -203 -6.78538 0.299
NP_441426.1_8 Forward -119 -101 14.3755 0.204
NP_441826.1_2 Forward -220 -206 4.91614 0.0979
NP_441826.1_2 Reverse -295 -309 1.86788 0.14
NP_441826.1_2 Reverse -199 -213 0.491246 0.184
NP_441826.1_5 Forward -359 -340 0.58944 0.3
NP_442490.1_9 Forward -347 -328 -9.047 0.299
NP_441764.1_8 Forward -376 -366 13.4162 0.284
NP_442868.1_6 Reverse -203 -213 6.66654 0.103
NP_442868.1_6 Forward -216 -206 0.0783647 0.248
NP_441056.1_1 Reverse -205 -224 -1.96717 0.193
NP_441056.1_1 Reverse -326 -345 -7.37537 0.272
NP_441612.1_2 Forward -30 -20 16.1975 0.209
NP_442361.1_3 Forward -220 -207 14.5723 0.115
NP_442808.1_1 Reverse -204 -214 9.71433 0.0481
NP_442808.1_1 Forward -177 -167 3.12618 0.248
NP_442820.1_3 Reverse -178 -188 15.4175 0.267
NP_442718.1_2 Reverse -167 -186 -5.40875 0.295
NP_442542.1_2 Reverse -203 -216 6.80412 0.205
NP_442050.1_5 Reverse -203 -213 11.7793 0.0832
NP_442342.1_9 Reverse -203 -219 7.13836 0.213
NP_440346.1_6 Reverse -28 -38 17.2569 0.14
NP_441114.1_3 Forward -174 -165 7.66954 0.231
NP_440558.1_2 Forward -263 -244 -3.93378 0.239
NP_441878.1_6 Reverse -204 -214 0.57002 0.14
NP_441878.1_6 Reverse -96 -106 -7.0998 0.204
NP_441878.1_6 Forward -31 -21 -7.39479 0.222
NP_441557.1_5 Forward -214 -205 1.08137 0.0794
NP_441557.1_5 Reverse -205 -214 0.589713 0.134
NP_441590.1_4 Reverse -339 -358 5.40686 0.279
NP_442066.2_9 Reverse -201 -214 7.09911 0.247
NP_442183.1_1 Forward -214 -200 16.9125 0.0129
NP_442183.1_9 Forward -300 -290 11.0914 0.229
NP_441574.1_1 Forward -353 -334 21.6323 0.0352
NP_441574.1_1 Forward -347 -328 -6.09707 0.273
NP_442170.1_5 Forward -214 -195 -2.75381 0.267
NP_442347.1_2 Reverse -206 -215 10.3245 0.058
NP_441037.1_4 Forward -355 -345 6.14821 0.278
NP_441633.1_3 Forward -216 -203 0.904263 0.112
NP_440136.1_2 Forward -213 -206 6.23397 0.171
NP_440136.1_2 Reverse -206 -213 6.13563 0.193
NP_442590.1_10 Reverse -205 -224 14.9458 0.113
NP_442998.1_5 Forward -187 -177 8.1415 0.271
NP_442998.1_5 Reverse -114 -124 7.55152 0.289
NP_442998.1_10 Reverse -207 -214 15.5754 0.0102
NP_442998.1_10 Reverse -334 -341 6.23397 0.157
NP_440299.1_1 Reverse -334 -347 2.87033 0.269
NP_441799.1_1 Reverse -201 -215 6.58715 0.167
NP_441007.1_10 Reverse -200 -213 8.57408 0.112
NP_441007.1_10 Forward -346 -333 1.10092 0.209
NP_440256.1_1 Forward -310 -291 -3.3438 0.131
NP_442961.1_7 Forward -108 -89 9.73422 0.263
NP_440087.1_1 Forward -350 -331 -9.047 0.288
NP_441559.1_8 Forward -180 -166 -4.62196 0.231
NP_441559.1_8 Reverse -16 -30 -4.81863 0.238
NP_440915.1_6 Forward -218 -204 10.6193 0.0301
NP_440134.1_2 Forward -337 -318 -1.18052 0.298
NP_440215.1_10 Forward -357 -338 14.7491 0.224
NP_442967.1_10 Reverse -294 -308 16.0965 0.222
NP_442866.1_1 Forward -77 -58 -3.14714 0.217
NP_441464.1_8 Forward -214 -200 5.89945 0.248
NP_442993.1_1 Reverse -298 -314 -11.4462 0.247
NP_442386.1_9 Reverse -204 -213 4.52254 0.297
NP_440570.1_5 Forward -230 -211 -3.73712 0.292
NP_441340.1_5 Forward -213 -206 13.5105 0.0314
NP_441340.1_5 Reverse -206 -213 5.84064 0.208
NP_441340.1_5 Forward -340 -333 4.07068 0.239
NP_441340.1_9 Forward -376 -366 12.7863 0.22
NP_442484.1_2 Forward -225 -206 15.3391 0.0375
NP_440168.1_9 Reverse -194 -213 -2.36049 0.28
NP_442950.1_1 Forward -48 -29 -5.9004 0.293
NP_440586.1_1 Forward -357 -338 11.6025 0.182
NP_440586.1_8 Forward -340 -333 12.8218 0.0395
NP_440586.1_8 Reverse -206 -213 9.47853 0.146
NP_440586.1_8 Forward -213 -206 5.74197 0.283
NP_442251.1_6 Forward -71 -64 7.11894 0.274
NP_441262.1_3 Forward -214 -207 14.7888 0.0223
NP_440027.1_3 Reverse -338 -356 2.96833 0.282
NP_443051.1_1 Forward -215 -206 7.47288 0.0571
NP_443051.1_1 Reverse -204 -213 -1.18024 0.297
NP_439984.1_3 Forward -348 -334 15.9285 0.136
NP_439937.1_8 Forward -352 -333 -4.72043 0.286
NP_439937.1_9 Reverse -18 -35 -10.6799 0.232
NP_439937.1_9 Reverse -17 -34 -11.0732 0.241
NP_442294.1_3 Reverse -174 -188 13.8636 0.252
NP_442294.1_3 Reverse -173 -187 13.077 0.274
NP_440371.1_4 Forward -175 -156 12.0933 0.189
NP_439943.1_4 Reverse -205 -224 10.2259 0.222
NP_440372.1_2 Forward -213 -206 13.8055 0.0214
NP_440372.1_2 Reverse -206 -213 6.52896 0.188
NP_441803.1_2 Reverse -158 -177 -0.787193 0.286
NP_442384.1_10 Reverse -21 -34 3.5592 0.186
NP_442262.1_10 Reverse -206 -213 13.2155 0.0213
NP_442262.1_10 Forward -340 -333 10.3639 0.153
NP_442262.1_10 Forward -334 -327 7.6106 0.274
NP_442244.1_3 Forward -307 -288 4.32602 0.259
NP_440344.1_10 Reverse -325 -342 -6.451 0.113
NP_440344.1_10 Reverse -198 -215 -10.5809 0.185
NP_442187.1_3 Forward -215 -205 15.6147 0.105
NP_441592.1_4 Reverse -15 -34 2.85105 0.186
NP_440700.1_8 Forward -354 -340 12.8809 0.242
NP_440894.1_10 Reverse -200 -219 9.24257 0.163
NP_440999.1_9 Reverse -201 -215 1.08123 0.171
NP_440999.1_9 Reverse -297 -311 -0.000409212 0.195
NP_440999.1_9 Forward -390 -376 -1.77037 0.249
NP_440999.1_9 Reverse -383 -397 -3.63866 0.299
NP_440888.1_2 Reverse -205 -219 9.04542 0.139
NP_442454.1_2 Reverse -74 -93 6.06331 0.298
NP_441543.1_2 Reverse -206 -215 7.07956 0.131
NP_442845.1_2 Forward -347 -333 9.14437 0.18
NP_442845.1_2 Forward -220 -206 5.40779 0.233
NP_441178.1_6 Reverse -340 -359 2.85027 0.27
NP_441319.1_8 Reverse -332 -350 16.6371 0.0686
NP_441918.1_7 Reverse -166 -185 -2.26216 0.297
NP_441469.1_1 Reverse -369 -388 12.1925 0.172
NP_442315.1_2 Forward -35 -23 8.9871 0.291
NP_443064.1_6 Forward -72 -62 8.88251 0.262
NP_442337.1_6 Forward -342 -323 12.5678 0.286
NP_442578.1_7 Forward -213 -206 6.0373 0.18
NP_441462.1_2 Forward -214 -204 16.1063 0.00406
NP_441462.1_4 Reverse -339 -358 6.88262 0.105
NP_441621.1_7 Reverse -194 -208 -5.9986 0.27
NP_441929.1_3 Forward -186 -167 3.34271 0.266
NP_443062.1_1 Reverse -205 -223 14.5914 0.0454
NP_443062.1_1 Reverse -332 -350 9.22847 0.138
NP_441601.1_4 Reverse -346 -365 -5.40875 0.293
NP_442204.1_2 Reverse -207 -226 11.8975 0.223
NP_441351.1_8 Reverse -95 -114 -0.000545616 0.292
NP_440516.1_8 Forward -214 -205 18.9776 0.00442
NP_440516.1_8 Reverse -205 -214 5.01461 0.118
NP_440516.1_8 Forward -341 -332 0.688044 0.136
NP_442428.1_5 Forward -213 -206 6.13563 0.209
NP_442428.1_5 Reverse -206 -213 6.0373 0.212
NP_442428.1_5 Reverse -333 -340 4.36568 0.271
NP_440783.1_5 Forward -366 -347 -1.67217 0.251
NP_440673.1_3 Reverse -207 -214 12.4288 0.0426
NP_441052.1_2 Reverse -205 -215 10.6981 0.0285
NP_441052.1_2 Reverse -332 -342 7.55152 0.0685
NP_441052.1_2 Forward -341 -331 3.81494 0.173
NP_441052.1_2 Reverse -21 -31 3.02829 0.185
NP_441052.1_2 Forward -347 -337 1.84832 0.225
NP_441052.1_2 Reverse -97 -107 0.963343 0.255
NP_442219.1_8 Reverse -201 -220 9.61661 0.224
NP_442219.1_9 Reverse -206 -215 7.96454 0.0696
NP_440436.1_4 Reverse -206 -215 7.57079 0.124
NP_441884.1_9 Reverse -202 -221 -24.5833 0.288
NP_440314.1_9 Reverse -333 -352 2.0644 0.0862
NP_440314.1_9 Forward -213 -194 -8.65367 0.251
NP_440314.1_9 Reverse -197 -216 -10.4236 0.298
NP_441719.1_4 Forward -213 -206 6.82395 0.0855
NP_441719.1_4 Reverse -206 -213 6.52896 0.188
NP_441733.1_10 Forward -217 -204 8.77074 0.135
NP_441004.1_1 Forward -347 -328 -12.7836 0.251
NP_441004.1_3 Forward -356 -337 5.11266 0.224
NP_442366.1_3 Reverse -297 -315 -4.30741 0.268
NP_442366.1_3 Forward -73 -55 -5.68405 0.292
NP_442366.1_5 Forward -217 -207 14.8275 0.0375
NP_441115.1_4 Forward -180 -162 8.96649 0.229
NP_441115.1_4 Reverse -162 -180 7.29487 0.291
NP_443054.1_2 Forward -177 -163 -0.492064 0.295
NP_442430.1_2 Reverse -328 -347 0.786102 0.297
NP_442856.1_7 Forward -356 -337 -5.11376 0.272
NP_442515.1_1 Forward -215 -201 -2.85201 0.281
NP_442515.1_1 Reverse -71 -85 -3.34366 0.29
NP_441396.1_5 Forward -36 -27 8.1612 0.224
NP_441046.1_2 Forward -352 -333 5.30933 0.227
NP_441046.1_2 Forward -42 -23 3.6377 0.231
NP_442689.1_8 Reverse -109 -126 -0.747806 0.202
NP_442843.1_1 Forward -302 -283 -10.3253 0.277
NP_440474.1_8 Reverse -333 -347 7.27547 0.207
NP_440396.1_10 Reverse -333 -349 14.5125 0.151
NP_441124.1_5 Reverse -114 -124 17.2098 0.168
NP_440588.1_2 Reverse -54 -73 -0.983855 0.155
NP_440588.1_2 Reverse -12 -31 -5.50708 0.252
NP_440195.1_4 Forward -226 -207 5.01433 0.29
NP_442006.1_2 Reverse -203 -220 -16.7758 0.264
NP_442006.1_2 Reverse -158 -175 -18.8407 0.296
NP_443047.1_7 Forward -213 -194 14.9458 0.0764
NP_440483.1_1 Forward -219 -200 6.58763 0.154
NP_441078.1_4 Reverse -21 -30 5.70292 0.111
NP_441078.1_4 Forward -214 -205 0.196389 0.205
NP_441078.1_4 Reverse -205 -214 -0.000272808 0.205
NP_442729.1_8 Forward -34 -21 9.16406 0.125
NP_442443.1_1 Forward -355 -336 -6.78538 0.298
NP_440526.1_3 Forward -213 -202 2.22148 0.267
NP_440526.1_3 Reverse -206 -217 0.64819 0.273
NP_441432.1_8 Forward -215 -206 14.0611 0.0258
NP_441432.1_8 Reverse -71 -80 5.21127 0.185
NP_442320.1_8 Forward -220 -206 -5.40861 0.225
NP_442344.1_7 Reverse -206 -225 -10.1286 0.287
NP_441732.1_2 Reverse -334 -350 -17.4444 0.258
NP_440760.1_1 Reverse -332 -351 -15.0452 0.14
NP_440760.1_1 Forward -214 -195 -22.5183 0.261
NP_440760.1_1 Reverse -205 -224 -23.1083 0.283
NP_440199.1_10 Forward -217 -207 7.25653 0.231
NP_442489.1_7 Reverse -332 -341 5.21127 0.077
NP_442489.1_7 Forward -214 -205 0.688044 0.152
NP_442489.1_7 Reverse -205 -214 0.688044 0.152
NP_440559.1_1 Reverse -206 -215 7.76787 0.0918
NP_440559.1_1 Forward -213 -204 6.39124 0.134
NP_441659.2_8 Reverse -205 -215 5.48657 0.106
NP_441659.2_8 Forward -214 -204 0.275027 0.27
NP_442913.1_10 Forward -223 -204 -1.27885 0.168
NP_441800.1_7 Reverse -336 -354 2.87075 0.204
NP_442346.1_2 Forward -352 -333 4.03102 0.293
NP_442346.1_5 Reverse -204 -214 4.3066 0.291
NP_440545.1_3 Reverse -334 -351 0.137172 0.144
NP_441856.1_6 Reverse -165 -179 17.9942 0.142
NP_440459.1_2 Reverse -203 -220 11.5436 0.173
NP_441653.1_2 Forward -225 -206 2.46664 0.291
NP_440010.1_10 Forward -217 -198 2.85105 0.27
NP_441943.1_8 Reverse -157 -176 -5.99873 0.261
NP_442603.1_7 Forward -214 -200 6.19383 0.253
NP_441833.1_4 Reverse -206 -213 6.52896 0.0924
NP_441833.1_4 Forward -213 -206 6.23397 0.163
NP_441329.1_3 Forward -120 -110 14.3283 0.256
NP_442162.1_9 Forward -213 -206 12.9205 0.0282
NP_442162.1_9 Reverse -206 -213 12.9205 0.0282
NP_440671.1_4 Forward -341 -327 13.3726 0.0834
NP_440671.1_4 Forward -220 -206 6.48943 0.245
NP_441973.1_1 Reverse -182 -197 0.766545 0.235
NP_442943.1_1 Forward -124 -109 4.73258 0.221
NP_442140.1_3 Reverse -206 -216 10.2065 0.0902
NP_442140.1_3 Forward -213 -203 7.35486 0.142
NP_442140.1_3 Forward -302 -292 5.38824 0.211
NP_441813.1_5 Reverse -203 -213 5.78156 0.109
NP_440590.1_4 Reverse -206 -219 9.55739 0.0347
NP_440567.1_1 Forward -213 -199 4.91614 0.109
NP_440567.1_1 Reverse -333 -347 1.86788 0.191
NP_442497.1_10 Forward -213 -204 1.08137 0.115
NP_442497.1_10 Reverse -206 -215 0.589713 0.153
NP_440821.1_4 Reverse -203 -213 7.35486 0.072
NP_440821.1_4 Forward -216 -206 -0.314959 0.251
NP_441239.1_9 Reverse -203 -215 12.9203 0.0402
NP_441951.1_9 Forward -302 -283 2.16274 0.254
NP_440546.1_4 Forward -214 -204 14.9908 0.0459
NP_440546.1_4 Forward -303 -293 6.55553 0.291
NP_440546.1_6 Forward -357 -338 11.8975 0.245
NP_442041.1_5 Reverse -164 -183 -0.0988766 0.266
NP_440441.1_5 Reverse -278 -297 21.4356 0.0768
NP_440462.1_6 Reverse -203 -213 6.46988 0.115
NP_440868.1_10 Reverse -204 -222 19.587 0.123
NP_442499.1_3 Reverse -331 -349 7.68896 0.282
NP_441474.1_1 Reverse -336 -355 -0.492971 0.255
NP_442402.1_4 Reverse -13 -32 4.12856 0.147
NP_440696.1_3 Reverse -201 -219 -4.20908 0.298
NP_442039.1_4 Forward -213 -206 11.6422 0.0747
NP_441811.1_1 Reverse -196 -215 7.66927 0.28
NP_440825.1_7 Reverse -206 -216 10.9578 0.278
NP_442837.1_3 Forward -213 -206 6.0373 0.25
NP_442837.1_3 Reverse -206 -213 6.0373 0.25
NP_442053.1_1 Reverse -205 -214 14.4544 0.0114
NP_442053.1_1 Forward -214 -205 7.86621 0.0863
NP_442053.1_1 Reverse -332 -341 4.42462 0.249
NP_440505.1_3 Forward -216 -206 7.64985 0.151
NP_441701.1_3 Forward -301 -284 8.59364 0.247
NP_442532.1_7 Reverse -63 -77 1.37622 0.289
NP_440914.1_1 Reverse -205 -215 13.1043 0.0386
NP_441011.1_8 Forward -213 -204 9.24284 0.131
NP_441011.1_8 Reverse -22 -31 5.3096 0.271
NP_442533.1_1 Forward -359 -340 -13.7669 0.238
NP_442533.1_6 Reverse -205 -214 4.42462 0.179
NP_442541.1_10 Forward -260 -246 3.44058 0.254
NP_439944.1_9 Reverse -333 -343 6.8632 0.165
NP_440116.1_8 Reverse -206 -225 11.3075 0.0278
NP_443045.1_9 Reverse -338 -356 8.96649 0.239
NP_441972.1_5 Reverse -206 -225 -6.39206 0.229
NP_441106.1_1 Forward -308 -299 2.55633 0.28
NP_440797.1_10 Forward -227 -208 5.50599 0.155
NP_441286.1_1 Forward -215 -203 13.8053 0.00558
NP_441286.1_1 Forward -342 -330 1.12062 0.0972
NP_440670.1_8 Forward -214 -205 8.75118 0.0606
NP_440670.1_8 Reverse -205 -214 6.19458 0.124
NP_440886.1_7 Reverse -204 -214 6.76441 0.114
NP_440886.1_7 Reverse -340 -350 3.12618 0.296
NP_440828.1_4 Reverse -337 -356 -1.77127 0.206
NP_442614.1_2 Forward -214 -200 8.06273 0.255
NP_442717.1_2 Forward -48 -29 -6.68705 0.282
NP_442072.1_9 Forward -215 -197 -22.007 0.216
NP_442072.1_9 Reverse -204 -222 -23.482 0.297
NP_440513.1_6 Forward -357 -338 9.93006 0.249
NP_442401.1_2 Reverse -337 -356 6.58682 0.294
NP_440907.2_8 Reverse -206 -216 5.87944 0.184
NP_442264.1_2 Forward -345 -328 8.00365 0.223
NP_441021.1_1 Reverse -333 -352 -9.73531 0.219
NP_441463.1_3 Reverse -186 -205 -9.83364 0.286
NP_441463.1_6 Reverse -330 -344 8.34861 0.25
NP_441626.1_2 Forward -213 -206 12.2322 0.0511
NP_441626.1_2 Reverse -206 -213 5.93897 0.231
NP_442794.1_1 Reverse -17 -29 5.34885 0.225
NP_442794.1_1 Reverse -59 -71 5.15219 0.231
NP_442794.1_1 Forward -218 -206 2.69391 0.286
NP_442615.1_1 Forward -39 -21 -0.7675 0.121
NP_441962.1_4 Reverse -327 -346 -12.8819 0.265
NP_440387.1_1 Reverse -338 -354 -4.56302 0.19
NP_440387.1_1 Forward -30 -14 -6.13632 0.268
NP_440387.1_1 Reverse -332 -348 -6.62797 0.298
NP_441431.1_2 Reverse -202 -216 12.487 0.116
NP_441488.1_8 Forward -219 -205 20.2551 0.0144
NP_441193.1_6 Forward -385 -366 5.11266 0.246
NP_441174.1_2 Reverse -60 -74 11.7993 0.28
NP_440814.1_4 Forward -223 -204 -11.8003 0.228
NP_440114.1_10 Forward -214 -200 13.8643 0.0481
NP_441510.2_7 Forward -220 -206 11.2087 0.28
NP_441272.1_7 Forward -37 -27 15.9097 0.2
NP_440766.1_4 Forward -218 -204 10.6193 0.0863
NP_441237.1_9 Forward -213 -203 14.1397 0.0488
NP_442743.1_4 Reverse -88 -107 -7.08038 0.279
NP_440457.1_1 Forward -218 -206 0.530633 0.25
NP_440457.1_1 Reverse -93 -105 0.333971 0.25
NP_441984.1_3 Reverse -201 -219 5.91901 0.276
NP_441332.1_6 Reverse -346 -356 10.9691 0.278
NP_442509.1_5 Reverse -340 -357 14.0994 0.246
NP_442509.1_9 Forward -214 -204 13.1559 0.061
NP_442509.1_9 Reverse -21 -31 6.96107 0.244
NP_442582.1_3 Forward -124 -110 16.4362 0.137
NP_443037.1_8 Forward -169 -150 6.09597 0.262
NP_440734.1_9 Reverse -338 -357 14.6508 0.201
NP_441885.1_5 Reverse -205 -215 1.25834 0.11
NP_441885.1_5 Forward -214 -204 -0.0199663 0.186
NP_442341.1_7 Reverse -204 -218 5.99778 0.139
NP_442341.1_7 Forward -215 -201 2.16287 0.267
NP_442341.1_7 Forward -107 -93 1.47456 0.288
NP_440423.1_6 Reverse -197 -216 -15.8318 0.229
NP_443000.1_7 Forward -216 -206 0.57002 0.294
NP_441842.1_10 Forward -221 -207 8.45605 0.221
NP_440275.1_3 Forward -216 -206 5.48657 0.145
NP_440275.1_3 Reverse -203 -213 1.25834 0.291
NP_440091.1_7 Reverse -26 -45 20.4514 0.102
NP_443010.1_10 Forward -217 -200 3.6405 0.252
NP_442451.1_2 Forward -222 -203 -8.85033 0.254
NP_441635.1_1 Forward -50 -31 7.59119 0.236
NP_442373.1_2 Forward -359 -340 -7.76869 0.237
NP_440216.1_1 Reverse -205 -219 -11.8985 0.228
NP_440216.1_9 Forward -64 -55 7.96454 0.286
NP_440172.1_1 Forward -214 -204 7.55152 0.0761
NP_440172.1_1 Reverse -205 -215 2.24165 0.279
NP_442015.1_10 Reverse -294 -307 -0.275709 0.259
NP_442015.1_10 Reverse -17 -30 -0.865694 0.285
NP_441226.1_7 Forward -213 -206 12.7234 0.0312
NP_441226.1_7 Reverse -206 -213 11.5435 0.0757
NP_441757.1_3 Reverse -20 -39 -2.55715 0.283
NP_441111.1_7 Reverse -206 -214 8.86921 0.0589
NP_441766.1_2 Reverse -205 -214 14.7494 0.00772
NP_440416.1_9 Forward -221 -202 -18.8801 0.266
NP_443052.1_9 Reverse -340 -359 -2.16383 0.233
NP_443052.1_9 Reverse -346 -365 -5.9004 0.274
NP_442552.1_9 Forward -222 -203 13.1758 0.255
NP_442116.1_6 Forward -124 -107 11.0337 0.214
NP_442403.1_9 Forward -353 -334 8.55425 0.191
NP_442154.1_1 Forward -358 -340 -15.7138 0.224
NP_442154.1_1 Forward -355 -337 -15.7138 0.224
NP_442226.1_8 Forward -123 -113 14.1397 0.26
NP_440261.1_5 Reverse -197 -210 -10.6988 0.203
NP_440261.1_5 Forward -213 -200 -10.7971 0.21
NP_440261.1_5 Reverse -333 -346 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTTGAGCTTACCGGTAATCATCAAATAAAACTTGCAACATCGGGGGGCGGAGGTTGTGGCCATCGAGATTGAACATAAATTCCTGGTTAAAGATGACCGCTGGCGGAGTTTAGTCCAGGGTTATTTGTACCGTCAAGGTTACATTGCCACCCCAGATTTAACTACGCTGCGAGTCCGTACCATTGGCGATCGGGCCTATCTCACCATTAAGGGTAAAAATGCCAGCATTGCCCGCTTGGATTTGAGTATGAAATTCTTGCAGTGGAAGCCAATTAAATTTTGACAGAACTCTGTTCACCGCCCCTGATTGAAAATATCGTTATTGCCTCGATTACCATGGTAAAACCTGAGAAGTAGACGAGTTTTTGGGGGATAACCAGGGTCTAATTTTAGCGGAA

CDS

GTGGAATTAACCTACACTGGTGAAAAAATAAGTCTACTTCCCTGGATCGGGGAAGAGGTAACGGATGATGCCCGCTATTACAACGTCAATTTAGCCCAACATCCCTACAAAAATTGGTGA

Protein

MELTYTGEKISLLPWIGEEVTDDARYYNVNLAQHPYKNW